KEGG   Pseudomyrmex gracilis: 109852450Help
Entry
109852450         CDS       T05003                                 

Definition
(RefSeq) actin-5, muscle-specific isoform X1
  KO
K05692  actin beta/gamma 1
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc04145  Phagosome
pgc04391  Hippo signaling pathway - fly
pgc04745  Phototransduction - fly
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04391 Hippo signaling pathway - fly
    109852450
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109852450
 09150 Organismal Systems
  09157 Sensory system
   04745 Phototransduction - fly
    109852450
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pgc03021]
    109852450
   03019 Messenger RNA biogenesis [BR:pgc03019]
    109852450
   03036 Chromosome and associated proteins [BR:pgc03036]
    109852450
   03029 Mitochondrial biogenesis [BR:pgc03029]
    109852450
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pgc04812]
    109852450
   04147 Exosome [BR:pgc04147]
    109852450
Transcription machinery [BR:pgc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     109852450
Messenger RNA biogenesis [BR:pgc03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     109852450
Chromosome and associated proteins [BR:pgc03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     109852450
    NuA4 complex
     109852450
  Chromatin remodeling factors
   BAF complex
    109852450
   PBAF complex
    109852450
   SWR1 complex
    109852450
Mitochondrial biogenesis [BR:pgc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    109852450
Cytoskeleton proteins [BR:pgc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     109852450
Exosome [BR:pgc04147]
 Exosomal proteins
  Proteins found in most exosomes
   109852450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 109852450
NCBI-ProteinID: XP_020279210
LinkDB All DBs
Position
Unknown
AA seq 376 aa AA seqDB search
MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
TQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKS
YELPDGQVITIGNERFRTPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANNVL
SGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK
QEYDESGPGIVHRKCF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgacgacgaagtagctgcccttgttgtagacaatggttccggcatgtgcaaagcc
ggtttcgccggagacgacgctcctcgcgccgtcttcccctcgatcgtcggtcgccctaga
catcagggtgtgatggtcggtatgggtcagaaagacagctacgtgggtgacgaagctcag
agcaagagaggtatcctgacattgaaatacccgatcgagcacggtattatcaccaactgg
gatgatatggagaagatttggcatcacactttctacaatgaacttcgagtcgctcctgaa
gaacatcctgttctactcacagaagcgcccctcaacccaaaagctaatcgtgaaaagatg
acgcagatcatgttcgaaaccttcaacagccccgccatgtatgtcgccatccaagccgtc
ctttcactgtacgcttccggtcgtaccaccggtatcgtcttggattccggtgacggtgtt
tctcacaccgtacccatctacgaaggttacgctcttcctcatgctatcctccgtctggat
ttggccggtcgcgatcttaccgactatctcatgaagatcctgactgagagaggctacagc
ttcaccaccacggctgagcgagaaattgtccgcgatatcaaggagaaactgtgctatgtc
gctttggacttcgaacaggaaatggctaccgctgccgctagcacatctctcgagaagagc
tacgagttgcctgatggtcaagtcattaccattggtaacgaaaggttccgtacgcccgaa
gctctcttccaaccttccttcctgggtatggaatcctgcggtattcacgagaccgtctac
aactccatcatgaagtgcgacgtcgatatccgtaaggatctgtacgccaacaacgttctg
tccggaggtaccaccatgtatcccggtattgccgatcgtatgcaaaaggaaatcactgct
cttgctccctcgaccatcaagatcaagatcattgctccacccgagaggaagtactccgta
tggatcggtggttccatcctggcttccctgtccaccttccaacagatgtggatctccaaa
caggagtacgacgagtccggtcccggcatcgtccaccgcaagtgcttctaa

DBGET integrated database retrieval system