KEGG   Pseudomyrmex gracilis: 109852587Help
Entry
109852587         CDS       T05003                                 

Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc03030  DNA replication
pgc03410  Base excision repair
pgc03420  Nucleotide excision repair
pgc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    109852587
   03410 Base excision repair
    109852587
   03420 Nucleotide excision repair
    109852587
   03430 Mismatch repair
    109852587
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pgc03032]
    109852587
   03400 DNA repair and recombination proteins [BR:pgc03400]
    109852587
Enzymes [BR:pgc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     109852587
    6.5.1.6  DNA ligase (ATP or NAD+)
     109852587
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     109852587
DNA replication proteins [BR:pgc03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    109852587
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     109852587
DNA repair and recombination proteins [BR:pgc03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     109852587
   NER (nucleotide excision repair)
    Other NER factors
     109852587
   MMR (mismatch excision repair)
    Other MMR factors
     109852587
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 109852587
NCBI-ProteinID: XP_020279444
LinkDB All DBs
Position
Unknown
AA seq 877 aa AA seqDB search
MLKTLATWSHVTWSLALRTRRLEFAAAARSRFTVIFNRIHTTNSNLSEKKDVLGNSKRKR
DKSIEPVSSPLKKNLNTNLKKPKTASKTPSPGAKSRAKPASKQNTNAKDAKKRKKNLSTV
RENDTDNEAKSCAKSVSEQNDNTKDKDAKKKKIDLSTAKEDDTENDSESSEESVFEQNDK
DAENKNVKDKDAKSKNGNLGTVKEDNAKSETNDKKANETSNNQSYNPIASKYDPINSACW
KRGDKTPYGAFTRTLELIEETSARLKIIEILSNYFRSVIVLSPTDLLPSVYLCLNQLAPA
YEGIELGVADTNLMKAIAQCTGRTLAQVKADVKRVGDCGLVAEGSRSNQRTMFQPAPLTV
SNVYSKLKEIAQMTGQASLGKKLDKIQTLFMACRNSEARYLIRSLAGKLRIGLAEQSVLQ
ALALACVTTPPEQTYPPENLDMSKTMSKDRFKERYDEIALILKTTYCECPNYDIIIPVLL
EDGVKALPNKCKLTPGIPLKPMLAHPTKGVQEVLTRFDGLKFTCEWKYDGERAQIHVSND
GKISIYSRNQENNTSKYPDIINRFKNTRGDSVKNCILDCEAVAWDKEKNQILPFQVLSTR
KRKDANEEDIKVQVCVFMFDLLYLNDEPLVKEPFSKRRELLKEHFKEVEGEWKFANSMDT
TTMEEVEVFLNESVKGNCEGLMVKTLEEEATYEIAKRSRNWLKLKKDYLDSVGDTLDVVV
IGGYTGKGKRTGTYGGFLLACYDQENEEYQSICKIGTGFKDEDLENHTKFLKDHVIPQAK
SYYRFDSSHEPDHWFEPVQIWEIKCADLSLSPVHKAAVGIVDPEKGISLRFPRFIRIRED
KNCEEATSAQQVADMYYNQEQIKNQTSGSKVTEEDFY
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaccctcgcgacttggtcgcacgtaacgtggtcgctggctttgcggactcga
cgtctcgagtttgcggccgcggctcgcagccgatttactgtcatatttaaccggatacat
acaaccaacagcaacttgtcagagaagaaggacgtattgggaaatagtaaacgtaagaga
gacaaaagtatcgaacctgtcagttctcccttaaagaagaacttgaatactaatcttaag
aaacccaagactgcttccaaaactccatctccaggtgcaaagtctcgagcaaaaccagca
tctaagcaaaatactaacgcaaaggatgcaaaaaagaggaaaaaaaatcttagtacagtg
agagaaaatgatacagataatgaagcaaagtcttgcgcaaaatcagtatctgaacaaaat
gataatacaaaagataaggatgcaaaaaagaaaaaaatagatcttagcacagcgaaggaa
gatgatacggaaaatgattcggagtcttctgaggaatcagtattcgaacaaaatgacaaa
gatgcagaaaataaaaatgtaaaagataaagatgcaaaaagcaaaaatggaaatcttggc
acagtgaaagaagataatgcgaaaagcgaaacaaatgataagaaagcaaatgaaacaagt
aacaatcaatcttacaatcctatcgcatctaagtacgatccgataaatagtgcgtgttgg
aaacgaggtgataaaacgccatatggcgcgttcacgcgcactttggaactcattgaggag
acgagcgccaggctgaagataatagagatattgtcgaattattttcgatctgtcatagtt
ctgagtccgacggatcttttgccgagtgtatatttgtgccttaatcaacttgcgccggca
tacgaaggaattgagctcggagttgctgacacgaatctaatgaaggcgatagcgcagtgc
actggaagaacgctggctcaggttaaagccgatgtaaagagggtcggcgattgcgggctc
gtagccgaaggcagcagatccaatcagagaaccatgttccaaccagcgccgttgacggtt
tccaatgtatattccaaactgaaagagatcgctcaaatgactgggcaagcgtctttagga
aaaaagctggacaagattcagaccctatttatggcgtgtcgtaatagcgaggcgagatat
cttattagatcgttagccgggaaacttcgcatcggactggcagagcaatccgttttgcag
gcgttggctctagcttgcgtaactacaccaccggaacaaacttacccaccagaaaatctg
gacatgagtaaaacaatgtcgaaggatcgcttcaaagagcgatatgacgaaatagcgctt
atactgaagacaacctattgcgaatgtccaaactacgacattataattcctgttttgctg
gaagacggcgttaaagctctacccaacaagtgcaagctcactcctggaatacctttgaaa
cctatgctggcgcatcccacaaaaggtgttcaggaagttcttacgcgattcgacggcttg
aaattcacgtgcgagtggaagtacgacggggaaagagcacagatacacgtttcgaacgac
ggcaaaattagtatttacagtaggaatcaagagaacaatactagcaaatatccggatatc
attaatcgatttaaaaatactcgcggcgattcggtaaaaaattgcatactcgactgcgaa
gcggtcgcctgggacaaagagaagaatcagatcttgccgttccaagtacttagcacgaga
aaacgaaaggacgccaacgaggaggacattaaagtgcaggtatgcgtgttcatgtttgat
cttttgtacttgaacgacgagccgttggtgaaggaaccgttctcgaaacgccgcgagttg
ctgaaggagcacttcaaagaagtggagggcgagtggaagttcgctaatagcatggatacc
acgacgatggaggaagtggaagtttttctcaacgagtccgtgaagggaaattgcgagggt
ctaatggtaaaaacgctggaggaagaggcaacctacgaaatcgcgaaacgctcgagaaat
tggttgaaattgaagaaggattacttggacagcgtcggcgatacgctcgacgtggttgtg
atcggtggttacaccggcaagggaaagagaactggcacatacggcggttttctcttggct
tgttacgatcaggaaaacgaggagtatcagagcatctgcaaaatcggcacaggctttaaa
gatgaagatctggagaatcacacgaaattcctcaaggatcacgtgataccccaggcgaaa
tcgtactaccgtttcgatagtagccacgagccggatcactggttcgagccggtccagatc
tgggagatcaaatgcgccgatctctccctctcgcccgttcacaaggcggccgttggaata
gttgatccggagaagggaatatcgttgaggtttccgcgatttattagaattcgcgaggac
aagaattgcgaggaggccacttccgcccagcaggtcgctgatatgtattacaatcaagaa
cagatcaagaatcaaacgtcgggatcaaaggtcacggaggaggatttctattaa

DBGET integrated database retrieval system