KEGG   Pseudomyrmex gracilis: 109854802
Entry
109854802         CDS       T05003                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen
  KO
K16679  wengen
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc04013  MAPK signaling pathway - fly
pgc04214  Apoptosis - fly
pgc04215  Apoptosis - multiple species
pgc04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    109854802
   04391 Hippo signaling pathway - fly
    109854802
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    109854802
   04215 Apoptosis - multiple species
    109854802
SSDB
Motif
Pfam: TNFR_c6 Trp_oprn_chp CD225
Other DBs
NCBI-GeneID: 109854802
NCBI-ProteinID: XP_020283858
LinkDB
Position
Unknown
AA seq 336 aa
MPKESCPGLLLTLVSVFVGLCESGGAMTSSAQQQPSQPAQQQQHHPVCRDGLEFWSTERG
TCLPCTRCAPEFTLSPCAVHKDAICGPLSALEIDWSFLSPAVRKRPPSESNDDVQRRLED
VTSKMFWRFPEERVTERLPESDNLVNSDRESDGSKADEQPVSALQQSKAAHDPRERRKSD
IEDGLSWDWQTGALVLAVCACIVFFLVAGCSALVYARQWRRMKKNFEPAGLEEISARLNL
MVKAELAELIAGAPMNPGDPETRCQYLEKLLDRKRETPVVAAASATAASGWPEAAAGNLY
IEEGDVTTPRSKRSQISRIQHDIETILSQKTNQVVD
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgccgaaggaatcgtgtcccggattgctgttgaccctggtgtcggtattcgtcggtctg
tgcgagtccggcggcgcgatgacatccagcgcgcagcagcagccgtcgcagccggcgcag
caacagcagcatcatccggtctgcagggacggtctggaattctggtcgaccgagcgcggc
acctgcttgccctgcacccgatgcgcccccgagtttactctgagcccgtgcgcggtgcac
aaggacgcgatctgcggcccgctgtcggcgctggagatcgactggtccttcctgtcgccg
gcggtcaggaaaaggccgccgtcggagtcgaacgacgacgttcagcgtcgcctcgaggat
gtaacctcgaagatgttctggcggtttcccgaggaacgggtcacagaacggcttcccgaa
agcgacaatcttgtcaattccgatcgggaaagtgacggaagtaaggccgacgagcagccg
gtctccgctttgcagcagtcaaaagcggcgcacgatccgagggagaggagaaaatcggac
atcgaggacggtctgtcgtgggattggcagaccggcgctctggttctcgctgtgtgcgcc
tgcatagtatttttcttggtggcaggatgctcggctctcgtctacgcgagacaatggcga
cgaatgaagaagaacttcgagccagcgggtctcgaggagatctcggcgagattgaatctc
atggtgaaggcggagctggccgaactgatcgcaggagcgccgatgaacccaggtgatccc
gagaccagatgccaatatctcgagaagcttttagaccggaaacgagagactccggtggta
gcagcggcgtcggcgacggcagcgagtggctggccggaggcggcggccggcaacttgtac
atcgaggagggggacgtaacgacaccgaggagcaagcggtcgcagatctcgcggattcag
cacgacatcgagaccattctcagtcaaaagacgaatcaggtcgtcgattga

DBGET integrated database retrieval system