KEGG   Pseudomyrmex gracilis: 109855163Help
Entry
109855163         CDS       T05003                                 

Definition
(RefSeq) maltase 2-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc00052  Galactose metabolism
pgc00500  Starch and sucrose metabolism
pgc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109855163
   00500 Starch and sucrose metabolism
    109855163
Enzymes [BR:pgc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     109855163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF3459
Motif
Other DBs
NCBI-GeneID: 109855163
NCBI-ProteinID: XP_020284644
LinkDB All DBs
Position
Unknown
AA seq 567 aa AA seqDB search
MVRLCVFVTVLAAATVSVSIRNAGKDWYKNSLVYQVYPRSFKDSDGDGIGDLNGITSKLG
HIVNIGADALWLSPIYTSPQFDFGYDVSNYTDVDKDYGTLADFDRLVATAKSLGLRIILD
FVPNHSSCEHEWFKKSVQRIKPYDEYYVWRDAKIVNGTRKPPNNWLSAVKGSAWEWNAAR
KQYYLHKFNVVQADLNYRSAALQREMKNVLTFWLNRGVDGFRIDAISHLYEDARFLDEPR
KNASPDDDEYETLDHIYTINLNETYAVLRSWRELLNNHSNTTDTRLILTEGDADFEAYYK
SGSNVPFNFMFILSLNNKSSAADFKRSIDSWMNLIPNNPDYVANWVVGNHDNHRVASRFG
EKRADQLSMLATILPGVSVIYNGDEIGMLDRNFTYAETVDPIGCIAGPNRYHLKSRDPAR
TPFHWDNSTSAGFSINNKTWLPVHTNYKTLNLAAQKTAAVSHYKVFQALTRLKRKPVIER
GSLETVLVTEKILGAVRRLDASVVALMVNFADTPVTVDARTWMNIPEQLIVYAPSVLSGL
LAGSRVDTTRITMPASASVVLTTADLV
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtctgtgtgtctttgtcacagttttagcggctgcgactgtttcggtatcaatc
aggaatgcgggtaaggattggtacaagaatagtttggtgtatcaggtttacccgagaagt
ttcaaagacagtgacggagacggtataggcgatttgaacggcatcacgagcaagttggga
cacatcgtgaacatcggcgctgacgcgttatggctgtcgccgatctacaccagcccgcag
tttgattttggctatgacgtctctaattacaccgacgtggataaggattacggcactctg
gccgatttcgacagactcgtggcgacggcgaagtctcttggactgcgaataattctcgat
tttgtgccgaatcacagctcctgcgagcacgaatggttcaaaaagagcgtacagcgaatc
aagccgtatgacgagtattacgtgtggcgcgacgcgaaaatagtaaacgggaccaggaag
ccaccgaacaactggctgagtgcggtcaaaggttccgcctgggaatggaacgcggcgcgg
aaacaatattatttgcacaagttcaacgtcgtccaggcggatctcaattatcgcagcgca
gctttgcaacgtgagatgaaaaacgtattgactttctggctgaatcggggcgtggatggc
ttccgcatcgacgctatcagtcacctgtacgaggacgcgcgtttcctggacgagccgcga
aaaaacgcgtcaccggatgacgacgaatacgagactctggatcatatttacacgataaat
cttaacgagacttacgccgttctgagatcttggagggaattgctgaataaccattcgaac
accactgacacgagattaatcctgactgagggtgacgcggatttcgaagcgtattacaaa
tcgggttcgaatgtgccgttcaactttatgttcattctcagtctcaataataaatccagc
gcagcagacttcaagcgatccatcgacagttggatgaatcttatacctaataatcccgac
tacgtcgcgaactgggtggtcggaaatcacgataatcatcgcgtagcttccagattcggt
gagaaacgggccgatcaactttccatgctggcgaccattctgcccggcgtgagcgtgatt
tacaacggcgatgagattggcatgctcgataggaattttacgtatgcggaaaccgtggat
cccattggttgcatcgccgggcccaacaggtatcatttgaagtcgagagatccggcgaga
acgccgttccactgggacaacagcaccagcgccggtttttccattaataataaaacctgg
cttccggtgcacaccaattacaagacgctgaatttagcggcgcagaagaccgcggccgtg
tcccattacaaagtattccaagcactaacgcgactgaagagaaagccggttatcgagcgg
ggctctctggaaaccgtattggtcaccgagaaaatcctaggagccgtacggcgactcgac
gcatctgtcgtggcgcttatggttaacttcgccgacacacccgttaccgtcgacgccagg
acttggatgaatattccggagcagttgatcgtttatgcgcccagcgtgctctccgggctg
ctcgccggatcgcgcgttgacacgactcgcatcaccatgcccgcttcggcttccgttgtg
ctcaccacagcagatttggtttag

DBGET integrated database retrieval system