KEGG   Pseudomyrmex gracilis: 109856042
Entry
109856042         CDS       T05003                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc00230  Purine metabolism
pgc01100  Metabolic pathways
pgc04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109856042
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    109856042
Enzymes [BR:pgc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109856042
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053
Other DBs
NCBI-GeneID: 109856042
NCBI-ProteinID: XP_020286461
LinkDB
Position
Unknown
AA seq 1005 aa
MSHRPVTNEDSYLSSGRPSNLLRTSFSSAHLEKLYRASSLQQRRGGFTCFLMSAILYGVY
TVITPGLELTARCIAIGYLNINIVLLVLAECCTHRVINRLWSVMRCCIGQYWILHMFAQM
LFKPGRVTPRDGLAWMLLLLYLLFAALPLKLSRCATLAIYSVLVYFVAVTGLTFTPEEFS
LLTNPPVDVLILTVTLFAGAAIMGACSYFLAEFQQRRAFLETRQSLEMQMLIEEQSAEQE
RLLLSVLPEHVAVKMRQDLGASLDTQFKKIYMSRHENVSILYADIVGFTAISSTYSASEL
VKILNELFARFDQLSERYEQMRIKILGDCYYCISGAPVERPDHAILSVHMGLSMVEAIKY
VQQTTNSPVDMRVGIHTGAVLAGVLGQRQWQFDVYSKDVELANKMESSGRAGRVHISNAT
LSFLNGEFEVEPAHGEDREEALQKAGLVTYFIVRALKPFKPAVTKSLASLADVENTQKTM
ENVSGKRNSKEDSEEFQQRLRKKLDSKGGDIDLVAHIFWWSLKFKDRNVEKEFVNVEEAF
SPLSLLGGPLVLLCAAPVWRLMPWGPFTWGGVGVVTLFAVVLAGATCLSSSIRAMWLKST
LALLMIFSISIFLIFDMGNCVFIENEAPSNTSLNTWSPRCPYPSYYSYIGVLVLIAISMP
TYLCYLTKAFLMYVLVGMQSYVNIVHFASHLDREDMTSNPYVPPSKIFPLKYMLSLTLVF
VANALIIVARYAEISRRMLYLRGREVIAQRERAADMKRRNGALIYNILPPHVAAYFLSHA
RHYDDLYSQSYSEVGVLFASMPNFADFYSEESINNQGLECLRFLNEVISDFDAILDHSNF
KNIIKIKTIGSTYMAASGITESAQPEDGPRWGHLVTLVEFALELKKALSSINEQSFNHFV
LKMGINHGPVTAGVIGARKPHYDIWGNTVNVASRMESTGKVGCIQVTDETRRILEPFGFG
FEQRGLVFVKGKGQLLTHYLISRDGVSLDLDSDLPVEPTHPIIYQ
NT seq 3018 nt   +upstreamnt  +downstreamnt
atgtcacaccgaccggtgacgaacgaggattcctacctgagctccggacggccgtcgaac
ctgctgcgtacgagcttcagcagcgcccatctcgagaagctgtaccgcgcctcgtcgctg
cagcagcgtcgcggcggcttcacgtgctttctcatgtcggcgatcctgtacggcgtttac
acggtgattacgccgggtctcgagctgactgcgcgatgcatcgccatcggttatctgaac
atcaacatcgttctgctggtgctggccgaatgctgcacccatagggtcatcaaccggttg
tggtcggtgatgaggtgctgcatcggtcagtactggatcctgcacatgttcgcgcagatg
ctcttcaaacccggcagagtcacgccgagggacggtctcgcctggatgttgcttctgctg
tacctactgttcgccgcgttgccgttgaaactgagccgttgcgcgaccctcgcgatttac
agcgtgctcgtgtacttcgtcgccgtgaccggtctcaccttcacgccggaggagttcagt
cttctcacaaatccgcccgtcgacgttctgatcctgacggtgacgctctttgccggcgcc
gctattatgggcgcttgcagctacttcctggcggagttccagcagcgccgggcgttcctg
gagaccaggcagagtctggagatgcagatgctgatcgaggagcagagcgcggaacaggag
cgactgctgctcagcgtcctgccggaacacgtcgccgtgaagatgcgccaggatctcggc
gcgtctctcgacacgcagttcaagaagatctacatgtccaggcacgagaacgtgtcgata
ctttacgcggatatagtcggcttcaccgcgatctcgtcgacctacagcgccagtgagctc
gtcaaaatactcaacgagctcttcgcgcgattcgaccagctcagcgaacgatacgagcaa
atgcgcatcaagatcctgggcgattgttactactgcataagtggcgcacccgtcgaaagg
cccgaccacgcgatcctcagcgtgcacatgggcctgtccatggtcgaggcgatcaagtac
gtccagcaaacgacgaacagccccgtcgacatgagggtgggcattcacacgggcgcggtg
ctcgccggtgttctgggccagaggcagtggcagttcgacgtttacagcaaggacgtcgaa
ctggcgaataagatggagagcagcggcagagccgggagggtacacatctcgaacgcgacg
ctgagcttcctaaacggcgaatttgaggtcgagccggcgcacggggaggacagggaggag
gcacttcaaaaagccggccttgtcacttactttatagtgagggccttgaagccgtttaag
ccggcggtgacgaagagcctggcgtcgctcgcggacgtcgagaacacgcagaagacgatg
gagaacgtgtccggcaagagaaacagcaaagaagactccgaagaattccagcagcgtttg
agaaagaaactcgacagcaaaggtggtgatattgacttggtcgcgcacatcttctggtgg
agcctgaagttcaaggatcgcaacgtggagaaggagttcgtaaacgtcgaggaggccttc
tcgccgttgtcgctcctcggcgggcctcttgtgttgctgtgcgccgccccggtctggaga
ctgatgccctggggaccgttcacgtggggtggcgtcggggtggtcactcttttcgccgtt
gtcctggccggtgccacttgtctgagcagctcaatcagggcgatgtggctcaaatcgacc
ctcgctcttctcatgatattttccatctccatcttcctgatcttcgacatgggcaactgc
gtgttcatcgagaacgaggcgccgtcgaacacgtcgctgaacacctggtccccgcgatgt
ccttatccctcctattactcgtacatcggcgtcctcgtgctgatcgcgatctcgatgccg
acgtatctctgttacctgaccaaggctttcctcatgtacgtcctagttggcatgcaatcc
tacgtcaatatcgtgcacttcgcctctcacctagaccgggaagacatgacgtcgaatccg
tacgtgcccccgtcgaaaatctttcctctgaaatacatgctgtccctcacgctggtcttc
gtcgcaaacgcgctaataatcgtggcgagatacgccgagatctcgcgaaggatgctgtat
cttcgcggacgggaagttatcgctcagagggaacgtgctgcggacatgaagcgaagaaac
ggcgcgctgatatacaacattctgcccccgcatgtcgcggcgtactttctgtctcacgcg
agacactacgacgatctttacagccagagctactcggaggtgggcgttctgttcgccagc
atgccgaacttcgcggatttctacagcgaggagagcatcaacaatcaaggcctcgagtgc
ctcaggttcctgaacgaagtcatctccgacttcgacgccattctcgatcattcgaacttc
aagaacatcatcaagataaagacgatagggtcgacctacatggccgcctcgggaattacc
gagtcggcgcaaccggaggacggtccccggtggggtcatctcgtcacactcgtggagttc
gccctcgagcttaagaaagctttatcgagcattaacgagcagagtttcaatcacttcgtc
cttaaaatgggtatcaatcacggaccagtgaccgccggtgtcatcggggcgcgaaagccc
cattatgacatttggggtaacaccgttaacgtagcctcgagaatggagagcacggggaaa
gtcggatgtattcaggtcacggacgagacgcgcaggatattggagcccttcggcttcggt
ttcgagcaacggggtctcgttttcgtgaagggcaagggacagctcttgacacactatctt
atctccagagatggcgtctctctcgacctcgacagcgatcttcccgtcgaacctacccat
cctataatttatcagtaa

DBGET integrated database retrieval system