KEGG   Pseudomyrmex gracilis: 109856932Help
Entry
109856932         CDS       T05003                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc00052  Galactose metabolism
pgc00500  Starch and sucrose metabolism
pgc01100  Metabolic pathways
pgc04142  Lysosome
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109856932
   00500 Starch and sucrose metabolism
    109856932
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    109856932
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pgc04147]
    109856932
Enzymes [BR:pgc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     109856932
Exosome [BR:pgc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109856932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 109856932
NCBI-ProteinID: XP_020288298
LinkDB All DBs
Position
Unknown
AA seq 1045 aa AA seqDB search
MVGIAATSGYKKPEQHTISVENSLNNTEVETDEEHTRIHDKTDEPVVKTNHEKRNIKLGH
PVIILCFFLYLALIYNIVCMLLYKNFGVPSCEGNPSVVYYFGFNHNKPCHHTIIEDKKIE
TDSLININNNDTIENIRYEDLETSSFDTYIDQQEYDYEIEHLKEEDTSSEAETTLKDAHC
TNVPEILRFDCHPENGASQLSCTQRNCCWNPPGKNIDATNRVPLNVPYCYYPKQWDLYTY
INYTQDGSNFSGYLKQKKTSAYKNDIPLVKMEATGINNSILRVKIYDPLKARYEPPWPIR
PDPKPDSISSQTNLQYKFTSTYASSGFKVDRVYDDTTLFNSIGIGGFIFADQFLQISTLI
PTNNIYGIGEHQSSLKLNTKWQSFTLFNKDQPPIENANLYGSHPFYIVIEKSGMAHGVLF
LNSNAMDVILQPTPAVTFRTIGGIFDIYFFLGPTPADVVKQYSEIVGKPFMPPYWSLGFH
LCRFGYRSLEGTRAVWNRTRAAGIPFDTQWNDLDYMDKNNDFTYNKKTFRDLPKFIEEIH
SVGMHYIPLIDAGISASENDGTYLPYDEGIKQDIFVKDGVTRKPFVGKVWNFVSTVWPDF
TNPKTTDYYAQMMGNMHDNFAFDGAWIDMNEPSNFYNGYKNGCMYNQLDYPEYVPNVVGD
LLATKTLCMNAKHYLGSHYDFHNTYGTSQAIATNYALRKIRQKRPFIISRSTWVGHGHYA
GHWTGDVYSLWHDLKMSIPAILSLNFYQIPMVGADICGFNGNTTVALCNRWMQLGAFYPF
SRNHNSDDTIEQDPVAMGNLVVRSSKNALKIRYRFLPYLYTLFFRAHKFGETVARPLFFE
FYDDRFTYDIDQQFLWGRSLMINPVLEENKTDVVVYVPHGLWYDYYTVQSFFSLGEYYIL
PAPIDTIPLLIRGGSILPAQTPGVTTTESRKNNFELLIALDENENANGELYWDDGDSIDS
IEKGEYLWLRFTVIKSELLSLKMDNSSFNEKVILGKVEMLGLKEITKLFLNGSEIEFSYN
AFTSSLIITDLHVDMRQQFMFSWLR
NT seq 3138 nt NT seq  +upstreamnt  +downstreamnt
atggttggtatagcagcaacaagtggatacaaaaaaccggagcagcacactatatcggtt
gaaaattctttaaataatactgaggtagaaacggatgaagagcacacaagaatacatgat
aaaactgatgagccagtagtaaaaacaaatcatgaaaaaagaaacataaagctaggccat
cctgtaataatactgtgtttttttttatatctcgctttgatttacaatatcgtttgtatg
ttgctgtataaaaattttggtgtcccgtcatgtgaaggaaatccttctgttgtttattat
tttggattcaatcataacaaaccttgtcatcatacaattatagaagacaaaaagatagaa
acagattctttgattaacataaataataatgatactattgaaaacataagatatgaagac
ttagaaacgtctagttttgatacgtacattgaccagcaagagtacgattatgagatagaa
catttaaaggaagaagatacttcatctgaagcagaaacaactctcaaagatgctcactgc
accaatgttcctgaaatattgcgctttgattgccatccagaaaatggagcgtctcaactc
tcctgcacgcaaagaaattgctgttggaatcctcctggcaaaaacattgacgctacaaat
cgtgtaccattaaatgtcccttattgttattatccaaaacaatgggacttatatacatat
attaactatactcaagatggtagcaatttctccggctatctcaaacagaagaaaacgtct
gcatataaaaacgacatacctctcgtaaagatggaggctacaggcataaacaattcaatt
ttgcgtgtaaagatatacgatcccttaaaagcgcgatacgaaccaccttggcccatcaga
ccagatccaaagcctgattcaatctcatcccagacaaacttgcaatataagtttaccagc
acttatgcgagttccggttttaaagttgatagagtttacgatgacactacattgtttaat
tctatcggaattggaggttttatatttgctgatcagtttttacaaatcagcacgttgata
ccaacgaataatatttacggcatcggcgagcatcaatcaagtttgaaattgaatacaaag
tggcaatcatttactttattcaataaagatcaaccgccaatagaaaatgcgaatttgtat
ggatctcatccgttttatattgtcatcgagaagtctggaatggcacatggtgttttattc
ttgaatagcaatgctatggatgtaatattgcaacctacaccggctgtaacatttcgaaca
atcggtggcattttcgacatttatttctttctgggaccaactccagcggacgttgtgaaa
caatattctgaaatcgtgggcaaaccatttatgccaccctattggtcgctcggttttcat
ttatgcagattcggatatagaagtttggaaggaacccgagcagtgtggaacagaacgaga
gcagctggaattccatttgatactcaatggaacgatttggattatatggacaaaaacaat
gacttcacatataataagaagaccttcagagatttgccaaagtttatagaagaaattcac
tcggtgggaatgcactacatcccgttaatcgacgctggtatatccgcttctgagaacgac
ggcacttatttaccgtacgacgagggaataaagcaagacatatttgtaaaagacggtgtc
acgcgcaaacctttcgtcggcaaagtttggaattttgtttccacagtatggcccgatttc
acgaatcctaaaacgacggattattatgcgcaaatgatgggcaatatgcatgataatttt
gcgtttgacggcgcatggattgatatgaatgaaccgtccaacttctacaacggctataag
aacggctgtatgtacaatcaactagattatcccgaatacgtgcccaatgtcgtcggcgat
ttgctcgcgacgaagactctgtgtatgaatgcaaaacattacttgggctctcattacgat
tttcacaatacttatgggacgagtcaagcaattgctacgaattacgctctcagaaaaatt
agacaaaaaagaccatttataatatcacgttccacgtgggtaggacacggtcactacgcg
ggtcattggacaggcgatgtttactcgttgtggcacgatttaaagatgagcattccagct
attttgtcgctcaatttctatcaaatcccaatggtgggcgctgacatttgcggttttaac
gggaacacaactgtcgcgttgtgtaatcgctggatgcaacttggcgcgttctatccgttt
tctcgtaatcacaattctgacgatacaatcgagcaggatccagttgcaatgggcaatttg
gttgtgcgatcttctaagaatgctctcaaaatacgttaccggttcttaccctacttgtat
actttgttctttagagcgcacaaatttggcgaaacagtggcgcgtccgttattttttgag
ttttacgatgaccggtttacttacgacatcgatcaacagtttctttggggaagatcactc
atgatcaatccagttctcgaagaaaacaaaactgacgtggttgtttacgtaccacatggt
ttgtggtacgattattataccgttcaatcgttcttctcgcttggagaatattatatttta
cctgcaccgatcgacacaataccactgttgattcgcggaggctcaatacttccggcacag
acaccgggtgtaactacaacggaaagtagaaagaataattttgaattactaatagcgttg
gatgaaaacgaaaatgccaatggagaattatattgggatgatggtgacagtatagactct
atagaaaagggagaatatttgtggttgcggtttaccgttatcaaatctgaattactgagc
ttgaaaatggacaatagttcttttaacgaaaaagtaattctcggaaaagtcgaaatgttg
ggattaaaagaaatcacgaaactcttcctaaatggcagtgagatagaatttagttacaac
gctttcacatcgagtttgatcatcactgacttgcacgtagacatgagacaacagttcatg
ttttcttggctgcgttag

DBGET integrated database retrieval system