KEGG   Pseudomyrmex gracilis: 109857205Help
Entry
109857205         CDS       T05003                                 

Definition
(RefSeq) histone-lysine N-methyltransferase EHMT2 isoform X1
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109857205
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pgc03036]
    109857205
Enzymes [BR:pgc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109857205
Chromosome and associated proteins [BR:pgc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109857205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank_3 Ank_5 Ank SET Pre-SET
Motif
Other DBs
NCBI-GeneID: 109857205
NCBI-ProteinID: XP_020288902
LinkDB All DBs
Position
Unknown
AA seq 1331 aa AA seqDB search
MADVTSSEGDNRLVATAENCRATAVKGTGDDGEEDKTATENSIYEILESMTNEFNKSVCS
VNNEKVETEKAATPSLPSKVVYEKSKEEKKSDVVNDEAASTQEVSVPEENHKSGEDSSSD
KTEPVKKDGGLTRIVLTFRTIDENTDHGKKTKISSCSNLTLVPDELVNCDQFGGVSVKIE
NSDENLEDSNVRKESEDTEESQSDKKKEVESAEKEESVKAKESIEEKESTNEQESTKETE
SKAIETDQAEDTVEKPNNDAQSHTQDKPETVENNVESNNVEAVLAEPIKQQEPIPILPTP
PLTRKRRAGRPRLRALSESIPQDEEQPGPKRSARRLSKESLKSTVLESAIARKEKSNYTE
EHSKKRKYNKPGRPKKVVQGKDQTKQGKDQTQVKLADVRQDLETSMLSDNNINTSENSML
ELSHNTTLSDNINDSIVEDSQSDFDGMPKLSPMTRNSDSQNKLNNSIGSPESDDIPLADI
EKPFLKPATSGRPKRERGRPRGSNQGARKIAKSDAYEDDSVSVAEAGKNNDYPEDLPAKR
TRRSTASSPSLAEGQASRPESTAIMSETYVQSMLCLCQMRSQLYVTITGPGAPLYCTALD
SIDNRVVGCCNEVDSKDVTMRRPSTRVPFIILCRMHTERMLRHNCCPSCGLFCSQGRFVQ
CSNGHQYHRGCEVYSHKRGVCPHCGSEGGNGTSYEVLITMNGMRKPVFIPTRKKFSKLPS
AKMSLPGKGDNTKLAGRPPSPLVKPDIIKIPEPSINTERPERYTIMSLYTSVKNGDLEKL
VNVLACGYNANHTFRDYAQRTGLHIAADKGHLSCVHVLVQAGAQVDVMDRNQLTPLMLAA
TKGNADVVKYLIRVGADVTLKGEDGMTALHMAAKSGHLKVCQIILTECKVPRTLVDSVDD
GGWTSLIWACEFCHTDVARYLLDKKCDPLIRDAEQNIALHWSAFSGSAEITEMLLNEGCD
VNAVNVHGDTPLHIAARQDQYTVCVLLLARGAKIGELNVAGETAVNCCPADGDTMTALRL
NAKVNELSEHMWEKTVKILTNDISRGKETNPIQCVNGYDSEDKPTDFVYVTENCFTSNIN
VDRTITSLQSCRCEDNCSSEKCLCGNISLRCWYDEEGKLVPEFNYADPPMLFECNPACDC
NRITCNNRVIQHGLTQRFQLFRTKGKGWGLRTLRFIPKGTYVCEYVGEIISDSEADHRED
DSYLFDLDNREIYSMYAQDGETYCIDARRYGNIARFINHSCAPNLLPVRVFVEHQDLHFP
RIAFFANRDIDADEELGFDYGEKFWIIKCKSFTCTCGAENCRYSEKTIQVTLDNYRRKIQ
QEEMQAAQISS
NT seq 3996 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgtcacttcctccgagggcgacaacagacttgttgcgacggccgagaactgt
cgcgcgacagcggtaaaggggaccggcgatgatggcgaagaggacaaaacggccaccgag
aacagtatttacgagatcctcgagagtatgacgaacgagttcaataaaagtgtgtgttcg
gtgaataacgagaaagtggaaacggaaaaggcggcaacaccatcgttgccttcgaaagtt
gtttatgagaaatccaaggaagaaaaaaagagcgatgttgtcaacgacgaggccgcttcg
actcaagaagtctctgtaccagaggaaaatcacaaaagtggggaggacagttcgtcagac
aaaacagaacctgtcaaaaaggacggtggtttgaccaggattgttctgacgttcaggacc
attgacgagaacacggatcatggcaagaaaaccaaaatatccagttgttctaatctcact
ctggtgccagatgagttggtcaattgtgatcagtttggtggtgtctctgttaagatagag
aattctgatgagaacttagaagattcaaatgtgaggaaagaatctgaagatacagaagaa
tcccaatcagataaaaaaaaggaagtggaatctgcagaaaaagaagaatctgtaaaagca
aaagaatccatagaagaaaaagaatctacaaatgagcaggaatctacaaaagaaacagaa
tcaaaagctatagaaacagatcaagcggaagatacggttgaaaagccaaataatgatgca
cagtctcacactcaagataaaccagaaactgtagaaaataatgttgagagcaacaatgtt
gaggcagtgcttgcagaacctatcaagcaacaagaacctattcctattctgcctactcca
ccgcttaccaggaagagaagggctggacgacctagattgcgagcacttagtgaatcaatt
cctcaagatgaagagcaacctggtcccaagcgttcagctagaaggctcagcaaggaatcc
ttaaaaagtactgtgttggaaagcgccatagcccgtaaagagaaatcgaattacacagaa
gaacacagtaagaagagaaagtacaacaaaccgggccggcctaaaaaagtggtacaaggc
aaggatcaaactaaacagggcaaggatcagactcaagtaaaactcgccgatgttcgtcag
gatttggaaacgtccatgttatccgataataatattaacacatccgaaaattccatgttg
gagttatcgcacaacaccacactgtccgataatataaacgacagcatcgtagaagattcg
caatcggactttgatggtatgccaaagttatcaccaatgacgagaaactcggactcgcaa
aacaaattaaacaactctatcggcagtcccgaaagcgatgacataccgttggcagatatt
gaaaagcccttcctgaaaccggctactagtggccggcccaagagggaaagaggacgtccg
cgcggaagtaatcagggcgcgcgaaaaattgccaagtcagatgcgtacgaagacgattct
gtatccgttgcagaagcagggaagaataacgattatcccgaagatttgccagccaagcga
actcgtcgtagtacggcgtcaagtccgagtcttgccgaaggacaggcctcaagaccggaa
tctacggctattatgagtgaaacgtatgtacaatcgatgctgtgtttgtgccaaatgaga
tctcagttgtacgtcactataacgggtcccggcgcgccgctttactgcaccgcactcgat
tcaatcgacaatcgtgtagtcggctgctgcaacgaagtggacagtaaagatgtgaccatg
cgacggccgagtactcgcgtgcctttcattattttgtgtcgtatgcatacagaacgaatg
ctgcgacacaattgctgtccttcctgtggtttgttctgttcgcaaggaagatttgtgcag
tgttctaacggacatcaatatcatcgcggctgcgaagtgtattcgcacaagagaggtgtg
tgtcctcattgcggcagcgaaggtggcaatggcacttcgtacgaagtgttgataacaatg
aacggcatgcggaaacccgtttttataccgacacgcaagaaattttccaaattgccctcg
gcaaagatgagtctgcctggcaagggtgacaatacaaagctggcgggacgtccacccagc
ccgctggtcaaacctgatatcattaaaatacccgaaccgtcgatcaacaccgaaagacca
gaacggtatactatcatgagtctgtacacatctgtgaagaacggggatctggagaaattg
gttaatgtattagcatgtggttataatgcgaatcacacattccgggattacgctcaacgt
actggtctgcacatagcggcagataagggccatctgtcatgtgtgcacgtactggtacaa
gccggtgctcaagtagacgtaatggataggaaccaattaacgccattgatgctagctgcg
accaagggtaatgctgacgtggtgaaatatctaattagagtaggcgccgacgttacattg
aagggtgaggacggcatgaccgctttgcacatggcggcgaaatccggtcatctgaaagtc
tgccagatcattctgaccgagtgtaaagtaccgagaacattagtagattctgtggacgat
ggcggctggacgagtttaatttgggcatgtgagttttgtcatacggatgtggcgcgatac
ttgctggataagaaatgcgatccgcttatccgagatgccgagcaaaacatagcgttgcac
tggagcgctttcagcggcagtgctgaaatcacagaaatgcttcttaacgagggatgcgat
gtgaatgctgttaatgttcacggcgatacacctttacacatagcagctaggcaggatcag
tatacggtctgtgttctcttgctcgcgcgtggtgctaaaataggggagttgaatgtcgcc
ggtgagaccgcggtaaattgttgccccgctgacggagacaccatgactgccctaagatta
aatgcgaaagttaacgaactttcggaacacatgtgggagaagacggttaaaattttaacg
aacgatatttcacgggggaaagaaacaaatcccatacagtgcgtcaatggatacgattct
gaagacaagccaaccgattttgtttacgtcacagagaactgcttcactagtaatattaac
gtagatcgtacaataacatcgttgcaatcctgtcgctgcgaagacaattgcagttcggaa
aaatgtttatgcggaaatataagtttgcgatgttggtacgacgaagaaggaaaactcgta
cccgagtttaattatgcagatccgccgatgttgtttgaatgtaatccagcttgcgactgc
aatcgtattacatgcaataatcgagttattcaacacggactgacacaaaggttccaactg
tttcgtacgaagggaaaaggttggggtcttcgaactctgagatttattcctaaaggcact
tacgtttgcgaatacgtaggcgagataatatcggattctgaggctgatcatcgcgaagat
gattcttacttgttcgatctggacaacagagaaatttactctatgtacgcacaggacgga
gaaacgtattgcatagacgctagacgttacggaaatatcgctcggttcatcaatcattct
tgcgcaccgaacttgctgccggtgcgtgtgttcgtcgagcatcaggatctgcactttcct
aggatagcgtttttcgccaatcgcgatatcgatgcggacgaagagctcggtttcgattac
ggcgagaaattctggataataaagtgcaagtctttcacatgtacctgtggagccgaaaac
tgccgttactccgagaagactatacaagttacgctggacaactaccgaagaaagatacaa
caggaggaaatgcaggcagctcaaatctcatcgtaa

DBGET integrated database retrieval system