KEGG   Pseudomyrmex gracilis: 109857671Help
Entry
109857671         CDS       T05003                                 

Definition
(RefSeq) hexokinase type 2 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc00010  Glycolysis / Gluconeogenesis
pgc00051  Fructose and mannose metabolism
pgc00052  Galactose metabolism
pgc00500  Starch and sucrose metabolism
pgc00520  Amino sugar and nucleotide sugar metabolism
pgc01100  Metabolic pathways
pgc01200  Carbon metabolism
Module
pgc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pgc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109857671
   00051 Fructose and mannose metabolism
    109857671
   00052 Galactose metabolism
    109857671
   00500 Starch and sucrose metabolism
    109857671
   00520 Amino sugar and nucleotide sugar metabolism
    109857671
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    109857671
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pgc04131]
    109857671
Enzymes [BR:pgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     109857671
Membrane trafficking [BR:pgc04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    109857671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 109857671
NCBI-ProteinID: XP_020289805
LinkDB All DBs
Position
Unknown
AA seq 502 aa AA seqDB search
MKTKNRSLFSKICRCYKKGTSRKNDNGELSLNPTVEPITVLVRRPCCDNNEMEMCTPEVS
KQIRDACKDLVLSNEQLRLVMQRLTDEINKGLSRETHDEAIVKCFTTYVQDLPNGTEKGN
FLALDLGGTNFRVLLITLDGQNFDMKSKIYAIPQTLMLGTGTQLFDHIAQCLALFVKDLN
LQNQVLPLGFTFSFPLTQRGLTQGHLVRWTKGFNCSGVIGEDVVALLEEAIRKRNDVKID
VCAILNDTTGTLMSCAWKNRNCRIGLIVGTGSNACYVEKTSNVRTAIPGNYDDKKPHMLI
NTEWGAFGEEGVLDFVTTEFDRAIDENSINPSKQLFEKMISGMYMGELTRLVLEKLVNDG
LLFGGKCPSDLRKRGKFFTKYVSEIENDPKGKYTNCRDVLAELGIRNVSDQDCENVRYVC
SVVSRRAAHLASAGLATLLNKMGENNVTVGIDGSVYRYHPHFHDLMTAKISELQSYKFDL
MLSEDGSGRGAALVAAVASQRR
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaagaacagatcattgttcagcaagatatgcagatgttacaagaaaggaaca
tcccggaaaaatgataacggtgaattgtctctaaatccaacggtcgagccgattacggtg
ctcgttcggagaccgtgttgcgacaacaatgaaatggagatgtgcacccccgaagtatct
aaacagatacgcgatgcctgcaaggacctggtcctgtccaacgaacagctccgtctggtc
atgcagaggctcaccgacgagatcaacaagggcctgtcgagagagacccacgacgaagcg
atcgtcaagtgtttcaccacatacgtgcaggatctgccaaacggcaccgagaaaggtaac
tttctggcgttggatctgggcggcacaaacttcagagtgttactgatcacgttggacggt
caaaacttcgacatgaagagcaaaatctacgcgatacctcagaccttgatgctgggcact
ggcactcagctgttcgatcatatcgctcagtgcctggcgttgttcgtgaaagacctgaat
ctgcaaaaccaggtgctgccgctgggattcactttcagttttcccctgacgcagagagga
ctgacacagggacatctggtgcgatggaccaaaggtttcaattgcagcggagtgatcggg
gaggacgtcgtcgcccttctcgaggaggcaattagaaaaagaaacgacgttaagattgac
gtgtgtgccatcctgaacgacacaaccggcaccttaatgtcatgtgcttggaagaataga
aactgtcggattggtttaatagtcggcacgggtagtaacgcctgctacgtcgaaaagacc
tcgaacgtgcggaccgccattcccggcaattacgacgacaagaaacctcatatgctcatc
aacaccgaatggggagcattcggtgaggagggtgtgctcgatttcgtgacgacggaattt
gaccgcgccatcgacgagaattccatcaatccgtctaagcagctattcgagaagatgatc
tccggtatgtatatgggcgagctcacgagattggtactcgagaaattggtgaacgacggt
cttctttttggcggcaagtgtccgagcgatctccgaaagaggggcaagttcttcaccaaa
tacgtatcagaaatcgaaaacgatcccaaaggaaagtacacgaactgtcgagacgtgttg
gccgaacttggtatacgaaatgtcagcgatcaggattgcgagaacgtgagatacgtgtgc
tcggtagtatcgaggagagcggcgcatctggcgagcgcgggattggcgacgttgctgaat
aaaatgggcgagaacaatgtcacagtgggtatcgacggttcggtctatcgatatcacccg
catttccacgacctcatgacggcaaaaatcagtgaacttcagagttacaagttcgatttg
atgctgtcggaagatggcagcggtcgtggtgcagctctggtcgccgcggtggcctcgcag
agacggtga

DBGET integrated database retrieval system