KEGG   Pseudomyrmex gracilis: 109857683Help
Entry
109857683         CDS       T05003                                 

Definition
(RefSeq) pre-mRNA 3'-end-processing factor FIP1 isoform X1
  KO
K14405  pre-mRNA 3'-end-processing factor FIP1
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    109857683
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pgc03019]
    109857683
Messenger RNA biogenesis [BR:pgc03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     109857683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fip1
Motif
Other DBs
NCBI-GeneID: 109857683
NCBI-ProteinID: XP_020289840
LinkDB All DBs
Position
Unknown
AA seq 557 aa AA seqDB search
MVAHNRSKTHTRTKPSHNSAWDRTLSLLQLIHASTNRCCYYLEKMADENEDQWLYGESTD
GKEYVPLDTHSETHQNDSSLANIQKISESQEDQETEKAGEVLSETQEDTGSPDGENEVSS
SMNNGQEEIMDSTKNGMKEVSSQEDGEAASDSDSDDDVHVVIGDIKSTPAYGSLNIKRGG
LLTNASGLPDKLTKQPGKFSIDEFETIGVINGIPAHEFNLDQLEDKPWRQPGADITDYFN
YGFNEETWRAYCERQKRMRSESGVGLILNTGSGGGNPNSIRVPQVAITNDNSKYSGISGP
KRAGPPPGRKMAGTIDVIGSSGLASRRNLDKSPPKGNVIQVMTADRREYSRKPGFPDMSV
PPPGPGLPPFDIPPPGYAGDPNSFYMPETDPYYQSYEPTQDNQWGNDPTWQPTNLAIPMT
EGDDDKDMAPKTIPTMVPPTSIPPLMQPRDQRDSRDRERDRDRDRELESVNRDKDRDKDR
DRDREKDSMIRDRDRDSMTRDDDRDRDRSRIQYRHKDRHRHRSRSRSRRHKSRSRSPSRR
KKKSRRSDRERSKEESE
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggtagctcataaccggtccaagacccatacacgcaccaaaccaagccataacagtgcg
tgggatcgtacccttagcttgttgcaattaatacatgcttcaactaatagatgctgttat
tatctcgaaaaaatggcggatgagaacgaagatcagtggttgtacggtgaatcaaccgac
ggaaaagaatatgtgccattagacactcactcagaaactcaccagaatgactcttcactc
gccaatattcagaaaatatctgaatctcaggaagatcaggagacagagaaagctggtgaa
gtattgtctgagacccaagaagatactggctcacctgatggtgaaaatgaagtgtcgtcc
tcaatgaataatggacaggaagagataatggactcgactaaaaatggaatgaaagaagtt
tccagtcaagaggatggtgaagcagcaagcgattccgattctgatgatgacgtccatgtt
gttattggtgatatcaaatcaacaccagcgtatggtagtttaaatatcaagcgaggtgga
ttgttgactaatgcatctgggttaccagataaactcaccaaacaaccaggaaagttcagt
atagatgaatttgaaactattggagttattaatggaataccagctcatgaatttaatctt
gatcagttggaagataaaccgtggagacaaccaggtgcagatattacagactattttaat
tatggttttaatgaagaaacttggagagcatattgtgaacgtcaaaagcgaatgcgaagt
gaatccggagtcggattaatcttaaacactggaagtggtggcggcaatccaaatagcata
agagtacctcaagtagcaattacgaatgataatagcaaatactctggtatttcaggccct
aaaagggcaggtccaccaccaggaaggaaaatggcaggcactattgatgttattggaagc
tctggtttagcttccagaagaaatttagataaatctccaccaaaaggaaatgttatacag
gttatgactgctgacagacgagaatattcgaggaagccaggttttcccgatatgagtgtg
ccgcctccaggaccgggattgccgccatttgatatacctcctccgggatacgccggagat
ccgaattcgttttacatgccggaaactgatccatattatcagagttatgagcctactcaa
gataaccaatggggcaatgacccaacatggcagccaacaaatttagcaatcccgatgacg
gaaggtgatgatgataaagacatggcgcctaaaacgatacctacgatggttccaccgaca
tccattcctcctctgatgcaaccacgtgatcaaagggacagccgagatcgcgagcgagat
agagatagagatcgggaattggaatctgtgaatagagataaagatagagataaagatcgg
gatcgtgacagagagaaagattctatgataagagaccgcgatagagattctatgacacgg
gacgacgatcgagatcgcgatagatccaggattcaatatcgacataaagaccgacataga
catcgatcaagatcccgatctcgtagacataaatcaagatcacgaagtccgagccgacga
aagaagaaatccaggcgctcagatagagaacgttctaaggaggagagcgaataa

DBGET integrated database retrieval system