KEGG   Pseudomyrmex gracilis: 109859894Help
Entry
109859894         CDS       T05003                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like isoform X1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc00020  Citrate cycle (TCA cycle)
pgc00190  Oxidative phosphorylation
pgc01100  Metabolic pathways
pgc01200  Carbon metabolism
Module
pgc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pgc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pgc_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109859894
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    109859894
Enzymes [BR:pgc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     109859894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like Thi4 FAD_binding_3 GIDA Herpes_IE68
Motif
Other DBs
NCBI-GeneID: 109859894
NCBI-ProteinID: XP_020294183
LinkDB All DBs
Position
Unknown
AA seq 685 aa AA seqDB search
MSESLEDFDHSTYVTACVQTWKIFAKMLHMSVNRLTRGIIKCVGQSRATIRYSRCFHVNV
SPTEKATVKCGNDSNLYPLIDHCYDVVVVGAGGAGLRTAFGLGSKGYRVAVVTKLFPTRS
HTVAAQGGINAAFEEENDNWLYHMYDTVKGSDWLGDQDAIHFLAREAPRAVYELENYGCP
FSRKDDGRIYQRPFGGQSLKFGQGGPACRTCAVADRTGHAMLHTLYGQSLRYEVHYFVEY
FALDLLMHGRCCKGILAWELETGQLHRFRAHHTVMATGGAERCYLSCTAAHACTGDGMAI
ACRAGLPLQDMEFIQFHPTGIYGSGILVTEGCRGEGGKLVNSEGEFFMEKYAPVAKDLAS
RDVVSRAMTIEIFEGRGVGEKKDHIHLQLSHLPHEVLRKRLPGVSHLAWVFAGVDVKTDP
IPVIPTVHYNMGGIPTNWRAQVLTRENEEDRAIEGLWSAGETACASVHGANRLGANSLLE
LLVFGKAIAEQIDCITRPGERHEDLPPDISEQSIWRFDATRYAKGCVPVAELRDEMQRTM
QTYCSIYRSCDILQRGCRDITRLYTCDLPDLCVQDQSLIWNTELVEALELQNMILCCMHT
VYAAENRKESRGSHAREDYKDRIDEYDYSKPLEGQKKRPFTEHWRKHTLTWAQEDGSICI
SYRPVIDTTLDETEAQHVPPAVRAY
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaagtctcgaagatttcgatcattcaacgtacgtgacagcgtgcgtccaaacc
tggaagatatttgcgaaaatgttgcacatgtcagtcaatcggctaacacgtggaataatc
aaatgcgtcggacaatctcgcgcgacgatcagatattcgcgatgctttcacgttaacgtc
agcccgacggaaaaggctacggtcaagtgcgggaacgatagcaacttgtatcctctgata
gatcactgttacgacgtggttgtcgtgggagcgggtggcgcgggattgaggaccgccttc
ggtctcggtagcaaggggtaccgcgtggcggtggtgaccaagctcttcccgaccaggtcg
cacaccgtggccgcgcagggtggaataaacgccgccttcgaggaggaaaacgacaactgg
ctctatcacatgtacgacaccgtcaagggatccgactggcttggcgatcaggacgccata
catttcctcgcgagagaagcgcctcgcgccgtctacgagctcgagaattacggttgtccg
tttagccgcaaggatgacggtaggatctatcagcgtcctttcggcggccagtcgttgaaa
tttggacaaggcggcccggcatgtcggacctgtgcggtcgccgatcgaaccggtcacgcc
atgcttcacaccctttacggacagagtcttcgttacgaggtgcactacttcgtcgagtac
ttcgccctcgatctcctgatgcacggtcggtgctgcaagggaattctggcgtgggaactc
gagaccggtcaactgcaccgatttagagctcatcacacggtgatggcgacgggcggtgcc
gagagatgttacctctcctgcaccgcggcgcacgcctgtaccggcgacggcatggcgatc
gcgtgtcgagcaggactgccgttgcaggacatggagttcattcagtttcatcccaccggc
atttacggcagcgggatattagtgaccgagggttgcagaggagaaggcggcaaactcgtc
aattccgagggggagtttttcatggagaagtacgcgccggtggctaaggatctggcgtcc
cgcgacgtcgtatcgagagccatgaccatcgaaatatttgagggaagaggcgtcggggag
aagaaggatcacattcatttgcaactgagtcatctgcctcacgaagtgttacgcaagaga
ctgccgggggtgtcgcatctcgcctgggtgttcgccggcgtggatgtgaagacggatccg
atcccggtgataccgaccgtgcattacaacatgggcggcatacccacaaactggcgtgcc
caagttttgacgcgggagaacgaggaggacagagcgatcgaaggtctctggtcggccggt
gagaccgcttgcgcatccgttcacggtgctaatcgactgggcgctaacagcctgttagaa
cttctcgtcttcggcaaagcgatcgccgagcagattgactgcatcaccagaccgggcgag
cgtcacgaggatctgccgccagacattagcgagcaatcgatttggcgtttcgacgcgacc
cgttacgcgaaaggttgcgttcccgtggccgagctgcgcgacgagatgcaacgcacgatg
cagacgtattgctcgatatacagatcctgcgacatcctgcaacgcggatgcagggacata
actcgactgtacacctgcgacctgccggacttatgcgtccaggatcaatctctcatttgg
aacacggagctcgtcgaggccttggagctgcaaaacatgatactctgttgcatgcacacg
gtgtacgcggccgaaaatcgaaaggaatcgagaggctcgcacgcgagagaggattacaag
gacagaatcgacgagtacgactattcgaaaccgctcgagggacaaaagaaacgacctttc
acggaacactggcgtaagcacacgctcacgtgggcgcaagaagacggatcgatctgcatt
tcttatcggcctgttatcgatacgactctcgacgagaccgaagcccagcacgtaccgccc
gcggttcgcgcatattga

DBGET integrated database retrieval system