KEGG   Pseudomyrmex gracilis: 109860044Help
Entry
109860044         CDS       T05003                                 

Definition
(RefSeq) glycogen [starch] synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc00500  Starch and sucrose metabolism
pgc01100  Metabolic pathways
Module
pgc_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    109860044
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pgc01003]
    109860044
Enzymes [BR:pgc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     109860044
Glycosyltransferases [BR:pgc01003]
 Polysaccharide
  Storage polysaccharide
   109860044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 109860044
NCBI-ProteinID: XP_020294479
LinkDB All DBs
Position
Unknown
AA seq 692 aa AA seqDB search
MSRERASRRFYRVDSTNDLFEFMDRGYTAQHENRWNFEVAWEVANKVGGIYTVIRSKAYV
STEEMGDQYCLIGPYKEHSARTEIEEADFPPHNPLYQAVQVLRDQGYKVVTGTWLVDGNP
QIILFDIGSAAWKLDEYKQELWNTCHLGIPHLDIEANDAVILGYLVCQFITEFRKAAENY
SSVPPRVVVHCHEWHAGVGLIALRTRHVDVATVFTTHATLLGRYLCAGKIDFYNNLDKFS
IDEEAGKRQIYHRYCMERAATHVAHIFTTVSDITGFEAEHLLKRKPDIITPNGLNVKKFA
ALHEFQNLHAISKEKIHEFVRGHFYGHYDFDLDKTLYFFIAGRYEFGNKGADIFIEALAR
LNHYLKTSRPDLTVVAFLIFPAKTNNFNVESLRGHAVTKSLRDTINDIQQKIGKRMYELC
LSGRMPDAQDLLQKEDTIKIKRCLYALQRNGLPPVTTHNVVDDWNDPVLNAIRRCNLFNT
VNDRVKMVFHPEFLSSTNPLFGLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSIT
TNLSGFGCFMQEHIADPMSYGIYIVDRRYIGLEASVQQLAQYMFDFARLSRRQRIIQRNR
TERLSDLLDWRNLGIYYRQARIKALTTVYPELASEYAEGGIGRFNYPRPISEPPSPSSSR
HTTPAASLHGSDDEDEVDDEKELEELRQTNGR
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagagaacgggcttccagaagattttatcgagtagatagcaccaatgatctgttt
gaattcatggaccgtggctacacagcccaacacgaaaatcgatggaacttcgaagttgct
tgggaagtcgccaacaaagttggcggcatttacactgtaataagatccaaagcctacgtc
tcaaccgaagaaatgggtgatcagtactgtctaatcggtccttacaaagaacattcggcg
cgcactgaaattgaagaggccgattttccgcctcacaatcctttgtatcaagctgtacaa
gtcttgcgcgatcaaggatataaagtggtgacgggaacgtggttggtggacgggaatccc
caaataattttgttcgatatcggaagcgcggcctggaaactggacgagtacaaacaggaa
ttgtggaacacttgccatctcggaatacctcatctggacatcgaagccaacgatgccgtg
atactcggatatttagtctgtcaatttattaccgaatttagaaaagcagctgagaactac
tcgagcgtgccgccgagagtggtcgtgcactgtcacgagtggcacgcgggtgttggattg
atcgctttgagaactagacacgtggacgtagccacagtattcaccacccacgctactcta
ctgggtcgatatctttgcgcgggaaagattgatttttacaacaatctggataagtttagc
atcgacgaagaagcgggaaagcgtcagatatatcacagatattgcatggaacgcgcggcc
acgcacgtggcgcacatattcactacggtctcggacataaccggtttcgaggccgagcat
ctgctcaaacgcaaacccgacatcatcacgccgaacggattgaacgtgaagaagttcgcg
gcgttgcacgagtttcagaatctacacgcgatcagcaaggaaaagatacacgagttcgtg
cggggtcacttttacggacattacgatttcgatctggacaaaacactgtatttctttatc
gctggccgatacgaattcgggaacaagggcgctgacatcttcatcgaggctctggccaga
ttgaatcactatctgaaaacgtccagacccgatctgacggtggtcgcgtttctcatcttt
cccgcgaaaaccaacaacttcaacgtcgagtctcttcgtggtcacgccgtaacaaaatcc
ttgcgagacaccatcaatgacattcagcagaagataggaaagcggatgtacgaattgtgt
ctgtccggtcgtatgcccgatgcgcaggatttgttgcagaaagaggataccattaaaata
aaacgatgtttgtacgctctccaaagaaacggactgcctcccgttacgacgcacaacgtc
gtcgacgattggaacgacccggtgttgaacgccatcagaagatgcaatctcttcaacacc
gttaacgatcgcgtcaagatggtgtttcatcccgagtttctgtcctcgaccaatccgctg
ttcggtctcgattacgaggaattcgtcagaggatgtcacctgggcgttttcccgtcctat
tacgagccgtggggatacacaccggccgagtgcaccgtaatgggcattcccagcataacc
accaacttgtcgggattcggatgcttcatgcaggaacacatagcggatccgatgagctac
ggcatctacatcgtcgaccgacgttacatcggtctcgaggccagtgtccaacagctcgcc
cagtacatgttcgatttcgcgcgactaagtcgtcgtcaacgtatcatacagagaaatcgc
acggaacgtctcagcgatcttctcgactggcgaaatctcggcatttactatcggcaggct
agaataaaagcgttgacgaccgtgtacccggaactggcgtcggaatacgccgaaggcgga
atcggtcggttcaattatcccagacccatcagcgagccgccgtctccgtcgtcctcgcga
cacacaacaccggccgcgtctttgcacggctcggacgacgaggatgaggtcgacgacgaa
aaggaactagaggaattgcgccagacgaacgggagataa

DBGET integrated database retrieval system