KEGG   Pseudomyrmex gracilis: 109860351Help
Entry
109860351         CDS       T05003                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
pgc  Pseudomyrmex gracilis
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pgc01002]
    109860351
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pgc04147]
    109860351
   04090 CD molecules [BR:pgc04090]
    109860351
Enzymes [BR:pgc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     109860351
Peptidases [BR:pgc01002]
 Metallo Peptidases
  Family M2
   109860351
Exosome [BR:pgc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109860351
CD molecules [BR:pgc04090]
 Proteins
  109860351
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 109860351
NCBI-ProteinID: XP_020294952
LinkDB All DBs
Position
Unknown
AA seq 691 aa AA seqDB search
MEFAFSRTNELSDYFSGSSIKWTLVLYLVSAVFGQLDLPPYTNDNVNQRRLPFNEVDYQN
ILARLDFLGAERCSANVAAQWAYETNVNEYTQLQALEAQRAYADFQYQAWLLTSKIDLFT
IQDPIIRRRIRYLSVVGPSALPPDQLDRYNRLINDMLAVYNGATICGYNDPFRCGLRLYP
DISQIMAKSRDWDELQYVWTEWRRRSGTPIKDLYQQLVTLNNDAARLNNFTDAAEYWMFP
YESPNFQQDIDEAWETIRPLYEELHAYVRRKLRELYGPERIGGHTSLPSHILGNIWGQSW
TNLLDVTLPYPGKIYPDVTQEMQAQGYTPIDMIRVAEEFYLSLNLSAMPPEFWAGSIIAD
PGDRPLICQASAWDFCNRLDYRIKMCTKVTMKDLITLHHEMGHIQYFLRYSGLPREFRDG
ANPGFHEAVGEAVALSVSTPRHLQTLGLANKFIDERAADINYLFALAMEKLVMLPFSITM
DRWRWDVFRGYINREEYNCHWHRLKEQYTGTKPPVLRSEDDFDPGAKYHIPANIPYIRNF
VAGVLQFQLYRSLCQAAGQRYVDDPRRPLHRCDFYRSPEAGRILGRLMEKGSSVPWQDTL
REATGEFRLDGAALREYFRPLEDWLRTENLRTSEVVGWSYDGDFCKRSIETAGLQVYGSG
FYNNGASIYASWITTGIMMILGTLSMFYLVQ
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggagtttgcctttagtcggaccaacgagctgtcggactacttcagcggaagttctata
aaatggacactcgtgctatacctggtatcagcagtttttggtcaattggatttgccaccg
tatacgaacgacaatgttaaccaacgacgacttcctttcaatgaagtggattaccagaat
atcttagctagattagatttcctcggagctgaaagatgcagtgccaacgtggcagctcag
tgggcgtacgaaactaatgtcaacgaatatacgcagctacaagcgctggaagcgcaacga
gcctacgcggatttccaataccaagcgtggcttctgacctccaagatcgatttgtttacc
attcaagatcctataatcagacgacggatccgttatttgtctgtcgtgggtccttcagca
ttgccacctgatcaactagacagatacaatcgactgatcaacgacatgctcgcggtttat
aatggagcgacgatatgtggttacaacgatcctttccggtgtggactgcgtctatatcca
gacatatcacaaatcatggcaaagagtcgagattgggatgagcttcaatatgtctggaca
gaatggcgcagacggagtggcacaccaattaaggatctgtatcaacaacttgttacatta
aacaatgatgccgcaagattgaataactttaccgatgccgccgaatactggatgttccct
tacgagtctcctaatttccagcaagatatcgatgaggcctgggaaacgatacgtcccctt
tatgaagaactgcacgcatatgttcgcagaaaattaagagaactctacggtcccgaaaga
atcggtggacacacgtctcttccgtctcacattcttggcaatatttggggacaatcttgg
actaatcttctggatgttactttaccgtatcctggaaaaatatatcccgatgtcacgcag
gaaatgcaagctcaaggctatacaccgattgatatgattcgagtggctgaagaattttat
ctgtccttgaacctgagcgctatgccaccggaattttgggccggaagtataatcgccgat
cctggcgatcgaccgttgatttgtcaagcttctgcgtgggatttttgtaatcgcttagat
tacaggattaaaatgtgtacaaaggtgacaatgaaggatttgataactttgcatcacgag
atgggacatattcaatatttcttgcgatatagcggcttaccacgcgaatttcgtgacggt
gcaaatccaggatttcacgaggctgtcggcgaggctgtcgccttgagcgtctctacgccg
cgtcaccttcagactctcggcttggcaaacaaattcatcgacgagcgcgcagcggatatc
aattatctctttgctttggcgatggaaaagctggtgatgctgccgttcagcatcacgatg
gacaggtggcgatgggacgttttccgcggttacatcaacagggaggaatacaattgtcac
tggcacagactgaaggagcaatacacgggcacgaaaccgccggttctgagatccgaggat
gactttgatccaggcgcgaagtatcacattccagcgaacatcccatacatccgaaacttc
gtggccggtgttcttcagttccaattgtatcgctcattgtgccaagctgccggacagaga
tacgtcgacgatccaaggagaccgttgcacaggtgcgacttttacaggagtcccgaagcc
ggccgaatcttaggacgattgatggagaaaggctcgtccgtgccatggcaggacacgctt
cgagaggccactggcgagtttagattggacggagctgctctcagagaatatttccgacca
ctggaggattggttgagaaccgagaatctgagaactagcgaagttgtcggctggtcatac
gatggtgacttttgcaaaagaagtatagagaccgcaggcctgcaagtttacggtagtggc
ttttacaacaacggtgcatctatctacgcatcttggatcacgacgggaatcatgatgata
cttggcacactgtcgatgttctatctagtgcaataa

DBGET integrated database retrieval system