KEGG   Pseudomyrmex gracilis: 109860549Help
Entry
109860549         CDS       T05003                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc00040  Pentose and glucuronate interconversions
pgc00051  Fructose and mannose metabolism
pgc01100  Metabolic pathways
Module
pgc_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    109860549
   00051 Fructose and mannose metabolism
    109860549
Enzymes [BR:pgc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     109860549
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Methyltransf_16 Phosphonate-bd 2-Hacid_dh_C UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 109860549
NCBI-ProteinID: XP_020295302
LinkDB All DBs
Position
Unknown
AA seq 350 aa AA seqDB search
MTRDNLTAILYGINDLRLENTSIEDPEDNEVLLEMGCVGICGSDVHYLVNGRIGDFIVKK
PMIIGHESSGTVAKLGKNVKNLKVGDRVAIEPGVPCRMCSFCKEGRYNLCKDIVFCATPP
VHGSLRRFYKHAADFCFKLPDHVSLEEGALLEPLSVAVHACKRGGIGIDSKVLILGAGPI
GLVTLLVAKAMGANKVVITDIVESRLNMAKKLGADDTYLVQRDKAEKDMVVDIHTIFGEE
PNKTIDASGAQASIRLAILATKSGGVMVVVGNTAPEIQIPLINAITREVDIRGVFRYAND
YKDALELVASGKVDVKPLITHNYKIEDTKQAFETSRTGAGGAIKVMIHCK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgacccgggacaatcttactgcgatactgtacggaattaacgatttgcgtctggagaac
acgagtatcgaagatccggaggacaatgaagtgcttctggagatgggatgcgtaggaatt
tgcggatcggatgttcattacctcgttaacgggaggattggtgacttcatagtgaagaaa
ccgatgatcataggccatgagtcttccggtactgttgccaaacttgggaagaacgtcaaa
aatttgaaggtcggtgatcgcgttgccatcgagcctggtgtgccatgcagaatgtgttcg
ttctgcaaagaaggacgttacaacttgtgtaaagacatagtattctgcgcaactcctccc
gtgcacggcagtttgagacggttttataaacacgcagctgatttctgcttcaagttgcca
gatcatgtaagcttagaggaaggagcgttgttggaacctttgtctgttgcagtgcacgca
tgcaaacggggtggaatcggaattgactccaaggtgttaatcttgggagctggtccgatc
ggtctagtaacattacttgtagctaaagccatgggagccaacaaagtagttattactgat
attgtagaaagtagactgaacatggcaaagaaactcggtgccgatgatacgtatctggtg
caaagagataaagcggaaaaggatatggtagttgacattcacacaattttcggcgaggaa
cctaacaaaacgatcgatgcctccggtgcacaagcctcaattcgtttggcgatcctcgcg
accaagtctggtggagtcatggtagtagtagggaacactgctccggagattcagattccg
ctgatcaatgcaataaccagagaagttgatatcagaggtgtctttcgatacgcaaacgac
tataaggatgcactagagcttgtcgcgtcaggtaaagtagatgtaaagccattaatcact
cacaattacaagatcgaagacaccaaacaagcgttcgagactagcaggacaggagctggt
ggagctattaaagtcatgattcactgtaaatga

DBGET integrated database retrieval system