KEGG   Pseudomyrmex gracilis: 109864250Help
Entry
109864250         CDS       T05003                                 

Definition
(RefSeq) UMP-CMP kinase
  KO
K13800  UMP-CMP kinase [EC:2.7.4.14]
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc00240  Pyrimidine metabolism
pgc00983  Drug metabolism - other enzymes
pgc01100  Metabolic pathways
Module
pgc_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:pgc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    109864250
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    109864250
Enzymes [BR:pgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.14  UMP/CMP kinase
     109864250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADK AAA_17 AAA_18 AAA_33 Zeta_toxin CPT AAA_19 AAA_16 ABC_tran AAA_30
Motif
Other DBs
NCBI-GeneID: 109864250
NCBI-ProteinID: XP_020300876
LinkDB All DBs
Position
Unknown
AA seq 218 aa AA seqDB search
MLLVSLATGARRCLRATMSAVTTKKPEVVFVLGGPGAGKGTLCRYIVDHYGYVHLSAGDL
LREERAKPGSIYGELIETHIRNGTIVPVEITCSLLDRAMQTSENPHHRFLIDGFPRNQDN
LDGWNKVMSNKVVLKGVIFCECSQEVCTQRCLNRGARGSGRSDDNEQSLILRHQTYLKNT
LPIIEMYEKQGLVYKVNGMKTPEEVFQDVADYFPKIGW
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggtcagtctcgcgaccggtgcgcgacgttgtctacgtgcgaccatgtccgcc
gtcacgacgaagaagccggaagttgtgttcgtcctcggtggcccgggtgctggtaagggc
acgctttgccgctacatcgtcgaccactatggttatgtgcatctgtcggccggcgatctc
ctgcgcgaggagcgcgccaaacccggctcgatatacggcgagctcatcgagactcacatc
cgaaacggcacgatcgtacccgtggagatcacttgcagtctgctcgaccgtgccatgcaa
acatccgagaatccgcaccaccgtttcctgatcgacggcttccccaggaatcaggataac
ctcgacggttggaacaaggtgatgtcgaacaaggtcgttctgaagggcgtgatattttgc
gagtgcagccaggaggtttgcactcagcgttgcctgaatcgcggcgcccgcggaagcggc
cggagcgacgacaacgagcagtccctgattctgcgtcatcaaacgtatctgaagaacaca
ctgcccatcatcgagatgtacgagaaacagggactggtttacaaagtcaacggcatgaaa
acgccggaggaggtgtttcaggacgttgcggattactttcccaagataggctggtaa

DBGET integrated database retrieval system