KEGG   Phaeobacter gallaeciensis DSM 26640: Gal_02507Help
Entry
Gal_02507         CDS       T02968                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
pgd  Phaeobacter gallaeciensis DSM 26640
Pathway
pgd00970  Aminoacyl-tRNA biosynthesis
pgd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Gal_02507
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pgd03029]
    Gal_02507
Enzymes [BR:pgd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Gal_02507
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Gal_02507
Mitochondrial biogenesis [BR:pgd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Gal_02507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey FimA
Motif
Other DBs
NCBI-ProteinID: AHD10252
UniProt: V9WMD5
LinkDB All DBs
Position
2519571..2521085
Genome map
AA seq 504 aa AA seqDB search
MLDLTYELPKPKVIAGAKHDWELVIGMEVHAQVSSNAKLFSGASTKFGAEPNSNVAFVDA
AMPGMLPVINDYCVEQAVRTGLGLKADINLWSAFDRKNYFYPDLPQGYQISQLYHPIVGE
GEVLVELGDGTARNVRVERIHMEQDAGKSIHDMDPNMSFVDLNRTGVCLMEIVSRPDIRG
PEEAAAYIAKLRQIMQYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFSHLGTRC
EIKNMNSMRFIQQAIDVEARRQIAIIEAGGTIDQETRLYDPDKGETRSMRSKEEAHDYRY
FPDPDLLPLEIEQAWVDDIAANLPELPDEKKGRFIKDFGLSDYDASVLTADVESATFFEE
TAKGRSGKLAANWVINELFGRLKKDEDKQITDSPVSPAQLGGIIDLISSDAISGKIAKDL
FEIVYTEGGDPAQIVEERGMKQVTDTGAIEAALDEIIAANPAQVEKAKVNPKLAGWFVGQ
VMKATGGKANPKAVNELVAKKLGE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacctgacatatgaactccccaagcccaaagtgatcgcgggcgccaagcatgac
tgggaactggtcatcggcatggaggtgcatgcccaggtcagctccaatgcaaagctgttc
tccggcgcctccaccaagtttggggctgagccaaactcaaacgtggcctttgtggacgcg
gcgatgcccggcatgctgccggtgatcaacgactattgcgttgaacaggccgtgcgcacc
ggtctgggtctcaaggccgatatcaacctgtggtcggcctttgaccgcaagaattatttc
taccccgacctgccgcagggttaccagatttctcagctttatcaccccatcgtgggcgaa
ggcgaagtgctggtggaactgggcgacggcaccgcacgcaacgtgcgggtggaacgcatc
cacatggagcaggacgcgggcaaatccatccatgacatggaccccaatatgtctttcgtg
gacctcaaccgcaccggcgtctgcctgatggagatcgtttcgcgccccgacattcgcggg
cccgaggaagccgccgcctatatcgccaaactgcgccagatcatgcagtatctgggcacc
tgcgatggcaatatgcagaacggcaacctgcgcgccgatgtgaacgtctcggtctgccgt
ccgggtcagtatgagaagtaccaggaaacccaggacttctcccatctcggcacccgctgc
gagatcaagaacatgaactccatgcgctttatccagcaggccatcgacgtggaggcccgc
cgccagatcgccatcatcgaggccggcggcaccatcgaccaggaaacccggctctacgat
ccagacaagggcgaaacccgttccatgcgctccaaggaagaggcgcatgactaccgctat
ttccctgatcccgaccttctgccgctggaaatcgaacaggcttgggtggatgatatcgcc
gccaacctgccggaactgccagatgagaaaaagggacgtttcatcaaggatttcggtctg
tccgattatgacgcgtcggtcctgaccgccgacgtggaatcggccaccttctttgaggaa
accgccaagggtcgcagcggtaagctggccgccaactgggtgatcaacgaactcttcgga
cgcctgaagaaggatgaggacaaacagatcaccgacagcccggtttccccggcgcagctc
ggcggcatcattgacctgatttcttcggacgccatctcgggcaaaatcgccaaggatctg
tttgagatcgtctataccgaaggtggcgacccggcgcagatcgtcgaagaacgcggcatg
aaacaggtcaccgatactggcgccatcgaggccgcgctagacgagatcatcgccgccaac
cccgcgcaggtcgaaaaagccaaggtgaaccccaaactcgcgggctggtttgtcggccag
gtgatgaaagccaccggcggcaaggccaaccccaaggccgtgaatgagctggtagccaag
aaactgggcgagtga

DBGET integrated database retrieval system