KEGG   Phaeobacter gallaeciensis DSM 26640: Gal_03123Help
Entry
Gal_03123         CDS       T02968                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
pgd  Phaeobacter gallaeciensis DSM 26640
Pathway
pgd00020  Citrate cycle (TCA cycle)
pgd00190  Oxidative phosphorylation
pgd00650  Butanoate metabolism
pgd01100  Metabolic pathways
pgd01110  Biosynthesis of secondary metabolites
pgd01120  Microbial metabolism in diverse environments
pgd01130  Biosynthesis of antibiotics
pgd01200  Carbon metabolism
Module
pgd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pgd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pgd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pgd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Gal_03123
   00650 Butanoate metabolism
    Gal_03123
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Gal_03123
Enzymes [BR:pgd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Gal_03123
    1.3.5.4  fumarate reductase (quinol)
     Gal_03123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_9 Fer4_16 Fer2 Fer4_18 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AHD10851
UniProt: V9WIJ5
LinkDB All DBs
Position
complement(3170881..3171660)
Genome map
AA seq 259 aa AA seqDB search
MVEFALPKNSKITTGKTWPKPEGATNVRKFSIYRWNPDDGKNPQVDTYFVDMDKCGPMVL
DALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGINTLACIYGLDEIKGDVKVYPLPHMP
VVKDLIPDLTHFYAQHASIMPWLETKTNRPAKEWKQSIEDRKKLDGLYECVMCASCSTSC
PSYWWNGDRYLGPAALLHAYRWIIDSRDEATPERLDELEDPFKLYRCHTIMNCAKTCPKG
LNPAKAISHIKQMMVERAV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaattcgcacttccgaaaaattccaagatcaccacgggtaaaacctggcccaag
cccgaaggcgcaaccaatgtgcgcaaattcagcatttatcgctggaacccggacgacggc
aagaacccgcaggtggatacctattttgtcgacatggacaaatgcggtccgatggttctg
gacgcgctcatcaagatcaagaatgagatcgatccgaccctgacattccgccgctcttgt
cgcgaagggatctgcggctcttgcgcgatgaacatcgacggtatcaacacgctagcctgt
atttacgggctggatgaaatcaagggtgacgtgaaggtctatccgctgccgcatatgccg
gtggtaaaggatctgatccccgatttgacgcacttctatgctcagcatgcctcaatcatg
ccgtggctggaaaccaagaccaaccgccctgcaaaagagtggaaacagtctattgaggat
cgcaagaaactcgacggtctttatgaatgtgtgatgtgtgcctcctgttcgacgtcctgc
cccagctattggtggaacggtgatcgctatcttgggccggccgcgctgctgcatgcgtac
cgttggatcatcgacagcagggatgaggcgacaccggaacgtctggatgagctggaagac
ccctttaagctctaccgttgccacacgatcatgaactgcgcaaaaacctgccccaagggt
ctgaacccggccaaggcgatttcgcacatcaagcagatgatggtggaacgcgcggtctga

DBGET integrated database retrieval system