KEGG   Phaeobacter gallaeciensis DSM 26640: Gal_03126Help
Entry
Gal_03126         CDS       T02968                                 

Definition
(GenBank) succinate dehydrogenase subunit A
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pgd  Phaeobacter gallaeciensis DSM 26640
Pathway
pgd00020  Citrate cycle (TCA cycle)
pgd00190  Oxidative phosphorylation
pgd00650  Butanoate metabolism
pgd01100  Metabolic pathways
pgd01110  Biosynthesis of secondary metabolites
pgd01120  Microbial metabolism in diverse environments
pgd01130  Biosynthesis of antibiotics
pgd01200  Carbon metabolism
Module
pgd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pgd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pgd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pgd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Gal_03126
   00650 Butanoate metabolism
    Gal_03126
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Gal_03126
Enzymes [BR:pgd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Gal_03126
    1.3.5.4  fumarate reductase (quinol)
     Gal_03126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 DAO FAD_binding_3 FAD_oxidored GMC_oxred_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: AHD10854
UniProt: V9WLY5
LinkDB All DBs
Position
complement(3172810..3174615)
Genome map
AA seq 601 aa AA seqDB search
MAAYEYETHDYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASL
SNMGPDHWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQR
PFGGHTTEFGEGPAVQRTCAAADRTGHAILHTLYGQSLKNNAEFYVEYFAIDLIMSEDGQ
CQGVVCWKLDDGTMHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLALQDM
EFVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPQYKDLAPRDYVSRSMTME
IREGRGVGEHGDHIHLNLSHLPAEALAERLPGISESAKIFAGVDVTKEPIPVLPTVHYNM
GGIPTNYWGEVLNPTAEDPTAVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAI
RAGKVVDADAPNPVLNQAQVDKAFDRFDGLRYAKGGIPTADLRLEMQRTMQSDAAVFRTS
ETMAEGVTKMTAIAAKIDDLAVTDRSLVWNSDLMETLELTNLMPNALATIVGAEARQESR
GAHAHEDFTSRDDEKWRVHTVSRVDGNKVDLTYRPVIVDPLTTEAEGGISEAKIAPKART
F
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttacgaatacgaaacacatgattatgacgtggtcgtggttggcgccggtggt
gccggcctgcgcgccaccctcggcatggcagagcaggggctgcgcacggcttgcgtgacg
aaggtcttcccgacccgctcgcataccgtggcggcccagggcggcattgcggcgtccttg
tccaacatgggtcctgaccactggcagtggcatatgtatgacacggtcaaagggtctgac
tggctcggcgatactgacgcgatggagtacctcgcgcgtgaagcgcccaaggcggtttac
gagctcgagcattacggtgtgccattctcgcggaccgaggaaggcaagatctaccagcgt
cccttcggtgggcataccaccgagttcggcgaaggccctgcagtgcagcgtacctgtgcc
gctgctgaccggaccggccacgcgatcctgcatacgctctatggtcagtcgctgaagaac
aatgctgagttctatgtcgagtattttgctatcgacctgatcatgtccgaggatgggcag
tgtcagggtgttgtttgctggaagctggacgatggcaccatgcatgtcttcaacgcgaag
atggtggtgctggcaactggcggttacggccgtgcctatttctccgcaacttctgcgcat
acctgtactggcgacggcggtggcatggtggcgcgggcaggccttgcgctgcaggatatg
gaattcgtgcaattccaccccacagggatctatggctccggctgtctgatcaccgagggc
gcgcggggcgaaggcgggtatttgaccaattccgaaggcgaacggttcatggagcgctat
gcgccccagtacaaggatctggcgccgcgtgactatgtttcgcgttcgatgaccatggag
atccgcgaaggccgcggtgtgggtgaacatggtgatcacattcacctcaacctcagccat
ctgccagccgaagcgctggccgaacgcttgccggggatttccgaaagcgcgaagatcttt
gccggcgtggatgtgaccaaggaaccgattccggttctgccaacggttcactacaacatg
ggcggtataccgaccaactactggggtgaggtgctgaacccgacagccgaggatccgacc
gctgtggtgccgggcctgatggccgtgggcgaggcgggctgtgcctcagttcacggggcc
aaccgattggggtccaactcgctcatcgaccttgtggtctttggccgagctgcggcaatc
cgtgcgggcaaggtggtggatgctgatgcgccgaacccggttctcaatcaggcgcaggtg
gacaaagccttcgaccggtttgacggtctgcgctatgccaagggcggcattccaaccgcg
gatctgcgtctggaaatgcagcgcaccatgcagagcgatgcggccgtgttccgcacatcg
gagaccatggcggaaggtgtgaccaagatgaccgccatcgcagcaaagatcgacgatctg
gctgtgacggaccggtcgctggtctggaactctgacctgatggaaacgcttgagctgacc
aacctgatgccaaacgccctggcgacaattgtcggggccgaggcacgtcaggaaagccgt
ggtgcccatgcgcatgaggatttcaccagccgggacgatgagaaatggcgtgtccatacc
gtgagccgcgtcgatggcaacaaggtggatctgacttaccgtccggtgattgttgatcct
ctcaccactgaggccgaaggcggcatcagcgaggcgaaaatcgcccccaaggcacggacg
ttctaa

DBGET integrated database retrieval system