KEGG   Phaeobacter gallaeciensis DSM 26640: Gal_03287Help
Entry
Gal_03287         CDS       T02968                                 

Definition
(GenBank) Pyruvate dehydrogenase complex, dehydrogenase (E1) component
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
pgd  Phaeobacter gallaeciensis DSM 26640
Pathway
pgd00010  Glycolysis / Gluconeogenesis
pgd00020  Citrate cycle (TCA cycle)
pgd00620  Pyruvate metabolism
pgd01100  Metabolic pathways
pgd01110  Biosynthesis of secondary metabolites
pgd01120  Microbial metabolism in diverse environments
pgd01130  Biosynthesis of antibiotics
pgd01200  Carbon metabolism
Module
pgd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pgd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gal_03287
   00020 Citrate cycle (TCA cycle)
    Gal_03287
   00620 Pyruvate metabolism
    Gal_03287
Enzymes [BR:pgd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Gal_03287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH_E1_M Transketolase_N DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: AHD11014
UniProt: V9WMC0
LinkDB All DBs
Position
3337485..3339878
Genome map
AA seq 797 aa AA seqDB search
MSDHRANSTVLEDLEKKALWLSTWTIHHANAIRPKSDSLKVGGHQASSASLSTLMAVLYG
AVLQPEDRVAVKPHASPIFHAWQYLLGRQTRENLENFRGFGGAQSYPSRTKDADDVDFST
GSVGLGGAMAVFSAMVQDYVAAKSWGKQAPGRMISILGDAELDEGNLYEALLEGRKHDLR
NCWWFIDYNRQSLDAVTKDAQNAFFRDVFASMGWEVVELKYGSLLEAAFAEPGGKQLRDW
IDGCSNQIYAALTFSGGAAWREQLLNDLGDQGDVSHLIESRTDDELARLMTNLGGHDQRS
LMQTIASIDHDRPVCFILYTVKGHGLPLAGHKDNHSGQINSAQLGILRDAHQIRTGHEWD
LFEGLSRPAAEYDAFLTKVPFIAQGCRRYTAARIDVPDLTPLSTKAALSTQEGFGKLLDD
LARSSSPLSDRILTMAPDVATSTGLAGWVNRKGVFAKSPIADEFRDRGIASMQKWAASPE
GAHIELGIAEMNLFTLLGAAGLSHALFGERLIPIGTLYDPFIERGKDALNYACYQDARFI
VAATPSGITLAPEGGAHQSIGTPLIGISQDGLASFEPAFVDELGCILEWSFDYLQRDGEE
TPEQGDWLRDETGGSVYLRLSTHKLEQPTRTLGGRLRRDIVNGGYWLRKPGPGCGLVIAY
TGVVAAEAIAAAGRIGQDQRDIGVLAITSADRLNAGWHAADRARALGHPNAQSHIETLLS
KVSRDAAIVTVTDGHPLALSWLGSVLGQRVRPLGVEHFGQTGSIADLYRAHRIDADAIMR
AAELALNGRPLRLARIS
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaccatcgcgcgaactccaccgttcttgaagacctcgagaagaaggcactctgg
ctatcgacatggacgatacaccacgccaacgccatccgcccgaaatcggattctctcaag
gttggtggtcatcaggcctcatcggcttcgctctcgaccctgatggcggtactctatggg
gcggtgctgcagcccgaggaccgggtcgccgtcaaaccgcacgcttctccgatctttcat
gcctggcagtaccttctcgggcggcagacccgcgagaacctcgaaaacttccgtgggttc
ggcggcgcacaatcttatccgtcccgcacgaaggatgccgatgatgtggacttttctaca
ggttcggtcggcctaggcggcgctatggcggtattttccgcgatggtgcaggattatgtt
gccgccaagagttggggcaagcaggctcccgggcgtatgatctctatcctcggagatgcc
gaacttgacgaaggcaacctctacgaggcgctgcttgagggtagaaaacacgatcttcgc
aattgctggtggttcatcgactacaatcggcaaagccttgatgcagtcacgaaagatgcg
cagaacgcgttctttcgcgatgtttttgcttcgatgggctgggaggtggtcgagctcaag
tacggatcgcttctagaggcagcgttcgccgaaccggggggtaaacagctgcgcgactgg
atagatggatgttccaatcagatctatgcggcgctgactttttccggcggggccgcctgg
cgcgaacaactgctgaacgatcttggtgatcaaggcgatgttagccacctgatcgagagc
cgcacggatgacgaactggctaggctgatgaccaaccttggtggtcacgaccagcgcagc
ttgatgcagactattgcttcaatcgaccatgatcgccccgtttgcttcatcctttacaca
gtcaagggccatggtctgcctcttgcgggtcataaggataaccactcgggccagatcaac
agcgcccagttggggatcttgcgtgatgcccatcaaattcgcaccgggcatgaatgggac
cttttcgagggtctgtcccgccccgccgccgaatacgatgcattcctgactaaggtaccc
ttcatcgcgcaaggttgtcggcgctacactgccgcgcgtatcgacgtgccggatctgacg
cctctatcgacaaaagccgctctgtcgacacaggaagggttcggtaaactactggacgat
cttgcgcgcagttcatcacctctatcggatcgcatcctgacaatggcaccggatgtggca
acctcgacaggactggctggatgggtaaaccgtaagggggtttttgccaaaagcccgatt
gcggacgagtttcgagataggggcattgcctcgatgcagaaatgggctgcatcgcctgaa
ggcgcacatatcgagttgggcattgccgagatgaatctctttaccctgctcggtgcagca
gggctgtcgcacgcgttgttcggcgagcggcttataccgatcgggacgctatacgatcct
ttcatcgagcgcggtaaggacgcgctgaactatgcctgttatcaggatgcccgcttcatt
gtggccgcgactccatccggcattaccctagcgcccgagggcggcgcgcatcaatccatc
ggaacaccactgatcggcatatcgcaagatggtctggccagtttcgaacctgccttcgtg
gacgagcttggctgcattctggaatggtcattcgactacttacagcgtgacggagaagaa
actcctgaacaaggcgactggctgcgcgatgaaaccggcggatcggtctatctgcgccta
tccacccacaagctggaacagccgacacgtacgttgggtggcagactaaggcgcgacatc
gtgaatggcggctactggctgcgcaagccgggtccgggttgcggcctcgtgatcgcctat
accggtgtggtagcagccgaagcgattgccgcagccgggcgaattggacaggatcaacgc
gacatcggggtgctggctatcacatccgcggatcggcttaacgccgggtggcacgccgca
gatcgagctcgcgccctagggcatcccaatgcgcaatcccatatcgaaacactgttgtcc
aaggtcagtagggatgcggccatcgtcacggttacggatgggcatcctctcgccttgtcc
tggcttgggtcggtcttgggtcagcgggttcgcccgctcggagtcgagcattttgggcag
accggatcaattgcagatctgtaccgcgctcaccgcatcgacgccgatgcgatcatgcga
gcggcggaactagcgctcaacgggcgcccgctccgtctggcccgaattagctga

DBGET integrated database retrieval system