KEGG   Pluralibacter gergoviae: LG71_11245Help
Entry
LG71_11245        CDS       T03300                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
pge  Pluralibacter gergoviae
Pathway
pge00030  Pentose phosphate pathway
pge01100  Metabolic pathways
pge01110  Biosynthesis of secondary metabolites
pge01120  Microbial metabolism in diverse environments
pge01130  Biosynthesis of antibiotics
pge01200  Carbon metabolism
pge01230  Biosynthesis of amino acids
Module
pge_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pge_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:pge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LG71_11245
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    LG71_11245
Enzymes [BR:pge01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     LG71_11245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C TPP_enzyme_C E1_dh HD_assoc XFP_C
Motif
Other DBs
NCBI-ProteinID: AIR00434
LinkDB All DBs
Position
complement(2355374..2357368)
Genome map
AA seq 664 aa AA seqDB search
MSRKELANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWNDFLRHNPNDPHWYDRDRFV
LSNGHASMLLYSLLHLTGYDLPLEELKNFRQLHSKTPGHPEYGLTPGVETTTGPLGQGLA
NAVGFAIAERTLAAQFNQPGHDIVDHYTYVFMGDGCLMEGISHEASSLAGTLGLGKLIGF
YDHNGISIDGETDGWFTDDTAKRFEAYHWHVVHEIDGHDPQAIKKAIEEARAVTDKPSLI
ICRTTIGFGSPNKAGKEESHGAALGEEEVALTRKQLGWNHPPFEIPKEIYRAWDAHEKGE
KAQQSWKEKFAAYKQAHPDLAAEFTRRMDSELPADWQKTADDYIAKLQSEPAKIASRKAS
QNALNVYGPALPEFLGGSADLAPSNLTIWKGSVSLKEEAAGNYIHYGVREFGMTAIANGI
SMHGGFIPYTATFLMFVEYARNAARMAALMKARQIMVYTHDSIGLGEDGPTHQAVEQLAS
LRLTPNFSTWRPCDQVETAVAWKAAIERSGGPTALILSRQNLAQMERTPDQVKAIAKGGY
VLKDAGGKPDLILIATGSEVEITVLAAEKLRAEGVNVRVVSLPSTDVFDAQDEAYRDSVL
PPDVSARVAVEAGIADYWYKYVGLKGAVVGMTTFGESAPADKLFPFFGFTVENIVEKAKK
VLKK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtaaagagcttgccaacgccatccgcgccctgagtatggacgcggtacagaaa
gccaattccgggcaccccggcgcgccgatggggatggccgatattgcggaagtgctgtgg
aacgattttctcaggcacaaccctaacgatccgcactggtacgatcgcgaccgcttcgtg
ctgtccaacggccacgcctctatgctgctctacagcctgctgcacctgaccggctacgac
ctgccgctcgaggagctgaaaaacttccgccagctgcactcaaaaacaccggggcacccg
gagtatggcctgacgccgggcgtggagaccaccaccggcccgctgggccagggcctggcc
aacgcggtcggtttcgccatcgccgagcgcaccctggcggcgcagtttaatcagcccggc
cacgatatcgtcgatcactatacctacgtgttcatgggcgatggctgtctgatggagggc
atctcccacgaagccagttccctggccggtaccctgggcctgggcaaactgatcggtttc
tatgaccacaacggcatctccatcgacggcgaaaccgacggctggttcaccgacgatacc
gcgaagcgctttgaagcctaccactggcacgtggtgcatgagattgacggccacgatccg
caggccatcaaaaaggcgattgaagaggcccgggccgttaccgataaaccctcgctgatt
atctgccgcaccactatcggcttcggctcgccgaacaaggccggtaaagaggagtcccac
ggcgcggcactgggcgaagaagaggtagccctcacccgcaagcagctgggctggaaccat
ccgccgtttgagatcccgaaagagatttaccgcgcctgggacgcccatgagaagggcgag
aaggcccagcagtcgtggaaagagaaattcgccgcctacaaacaggcgcatcccgacctg
gccgccgagttcacccgccggatggacagcgaactgcccgccgactggcagaaaaccgcc
gacgactatatcgccaagctgcagtccgagccggcgaaaatcgccagccgcaaggcctcg
cagaacgcgcttaacgtttatggcccggcgctgccggaatttctcggcggctccgctgac
ctggcgcccagcaacctgaccatctggaaaggctcggtgtcgctgaaggaggaggccgcg
gggaactatatccactacggcgtgcgcgagttcggcatgaccgccatcgccaacggcatc
agtatgcacggcggctttattccctacaccgcgaccttcctgatgtttgtcgagtatgcc
cgcaacgcggcgcgcatggcggcgctgatgaaggcccggcagatcatggtttatacccac
gactccatcggtctgggggaagacggcccgacccaccaggcggtcgagcagctggcaagc
ctgcgcctgacgccgaacttcagcacctggcgcccctgcgatcaggtggagacggcggtg
gcctggaaagcggccatcgagcgtagcggcggaccgacggcgctgatcctctcccgccag
aacctcgcccagatggagcgcaccccggatcaggtgaaagcgatcgccaaaggcggctac
gtgctgaaggacgcgggcggtaagccggatcttatcctgatcgccaccggctcggaggtt
gagattacggtactggccgccgagaagctgcgggcggaaggcgttaatgtgcgggtggtc
tccctgccctcgaccgacgtgtttgatgcccaggatgaggcctaccgcgattcggtgctg
ccgccggatgtcagcgcccgcgtcgccgttgaggcgggtattgccgattactggtacaag
tacgttggcctgaagggcgcggtggtcggcatgaccaccttcggcgaatcggcgcccgcc
gataagctgttcccgttctttggctttacggtagagaatatcgtggaaaaagcgaagaag
gtgctgaagaaatag

DBGET integrated database retrieval system