KEGG   Pluralibacter gergoviae: LG71_12235
Entry
LG71_12235        CDS       T03300                                 

Definition
(GenBank) 4-oxalocrotonate decarboxylase
  KO
K01617  2-oxo-3-hexenedioate decarboxylase [EC:4.1.1.77]
Organism
pge  Pluralibacter gergoviae
Pathway
pge00362  Benzoate degradation
pge00621  Dioxin degradation
pge00622  Xylene degradation
pge01100  Metabolic pathways
pge01120  Microbial metabolism in diverse environments
pge01220  Degradation of aromatic compounds
Module
pge_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:pge00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LG71_12235
   00622 Xylene degradation
    LG71_12235
   00621 Dioxin degradation
    LG71_12235
Enzymes [BR:pge01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.77  2-oxo-3-hexenedioate decarboxylase
     LG71_12235
SSDB
Motif
Pfam: FAA_hydrolase gp12-short_mid
Other DBs
NCBI-ProteinID: AIR00624
UniProt: A0A1S2BMM7
LinkDB
Position
complement(2563473..2564264)
AA seq 263 aa
MNLSQTTREQLATYLEEAELQRKEVIKITDQYPDMDWEDAYAIQDIIRARKVARGVQISG
LKMGLTSHAKMKQMGVTEAIHGFITDYGSVADGGEIACSELIHPKVEAEIAFVTKRPLKG
PGCHIGDVLAATDFVLPALEVIDSRYKDFRFDLKSVIADNTSSARYVLGGYSRSPMGLDL
RNLGVVMHKNGEVVATAAGSAVLGHPASSVAMLANMLGARGQEIPAGTLILTGGMTEAVP
VSAGDSITVSYQNLGSLSVRFTR
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaatctgagccaaacaacgcgcgagcagctggcaacctatctggaagaggcggagctg
cagcgcaaagaagtgatcaaaattaccgaccagtatcccgatatggactgggaggacgcc
tacgccattcaggatattatccgcgcccgcaaagtggcgcgcggcgtgcagataagcggc
ctcaaaatgggcctgacgtcccacgccaagatgaagcagatgggcgtaaccgaagcaatc
cacggcttcattaccgactatggctcggtggcggacggcggcgaaatcgcctgctccgag
ctgattcatccgaaggtcgaggcggaaattgcctttgtgacgaagcgaccgctcaagggt
cccggctgccacatcggcgacgtgctggcggcaaccgatttcgtgctgcccgcgctggag
gtcatcgactcgcgctacaaggatttccgcttcgatctgaaaagcgtgattgccgataac
acctcttccgcccgctatgtgctcggcggctacagccgcagcccgatggggctcgacctg
cgcaatctcggcgtggtgatgcataaaaatggcgaagtggttgccaccgccgccggttcg
gcggtgctcggacacccggccagcagcgtagcgatgctggcgaatatgctgggcgcgcgc
ggccaggagatcccggcggggacgcttattctcaccggcggcatgaccgaggccgtgccg
gtcagcgcgggcgacagcattaccgtcagctatcagaatctgggcagtttatccgtgcgg
tttacccgctag

DBGET integrated database retrieval system