KEGG   Pluralibacter gergoviae: LG71_15820
Entry
LG71_15820        CDS       T03300                                 

Definition
(GenBank) hypothetical protein
Organism
pge  Pluralibacter gergoviae
SSDB
Motif
Pfam: OmpA
Other DBs
NCBI-ProteinID: AIR01271
LinkDB
Position
3362039..3363751
AA seq 570 aa
MSPAQHRLLVLWAGLLVAVVCLAFLPGSRLLSVLVLLAAWAGIALVGFLTRPRPSGEPDI
ALSGLPEACWRHPVMLVCGDLPRGWPDAQPVIVCAGGCWIRVAESEQLMRTVQHLLWLRP
QWGRQLAVIVSIRPQRHTDTGALTTMLLGLRWQITQLRRKTRYAFPLLLNGLVGSRMMKD
ALWQSAMPGENLSVWRASSAPSSIAAWVTTGGAMAVEQQVMMNSLMDWFRQHVKTIFIEE
GPDLPPVKPAAVLWGLMPGLPGALPSSLWSRWLSQHTALNQVEDWLPVQEAQDDALLFPE
FILPLLPEGAGLTPRQRTGRYALGMFTLAAGTALLCSAWNNHRLIQRVSFDIAHYYQTSV
DEAARKAGAVAVLREDARQLDGWARSGEPLRMGLGLYHGGRLHLPVLEAIRTYRPLPTPV
QPSAPVPDAPQTVRLNSMALFDTGQSALKPGATKLLVSALVGIKARPGWLIVVSGHTDST
GSPPVNQALSLRRAEAVRDWMRDTGDVPGSCFAVQGYGAGRPAATNDTPEGRAQNRRVEI
SLVPQADACRAPGEPPAPSKDDGASHLRGE
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgagccctgcgcaacaccggctgctggtgctgtgggccgggctgctggttgctgtcgtc
tgcctggcttttctgcccggctcccgccttctgtcggttctggtgctgctggctgcctgg
gcggggatcgcgctggtcggttttttaacccgtccccgcccgtccggggagcctgatatt
gcgctttctggcctgccagaggcctgctggcgccatccggtgatgctggtctgcggcgat
cttccgcgcggatggccagatgcgcagccggtcattgtctgcgccggcgggtgctggatc
cgcgtggcggaaagtgagcagctgatgcgcacggtgcagcatctgctgtggctgcggccg
cagtggggacgtcagctcgcggtgattgtcagcattcgtccgcagcgccataccgatacg
ggggcactgacgacgatgctgctcgggctgcgctggcaaattacccagctgcgcagaaaa
acgcgctatgcctttccgctattgctcaatggtctggtggggagccggatgatgaaggac
gcgctctggcagtctgccatgccgggggaaaatctcagcgtctggcgggcgtcctccgca
ccgtcctctattgccgcctgggttaccaccggcggggcgatggcggtggagcagcaggtg
atgatgaacagcctgatggactggtttcgccagcacgttaaaacgattttcatcgaagag
ggcccggacctgccgccggtgaagccagccgccgttctgtgggggctgatgccggggctg
cccggggcgctgccttcctcgctctggtctcggtggctgtctcagcacaccgccctgaat
caggtggaggactggctccccgtgcaggaagcgcaggacgacgccctgctgtttcctgaa
tttattctgccgctgctgccggaaggcgcaggactgacgccgcgtcagcgaaccgggcga
tatgcgctggggatgttcacgctggcggcgggcacggcgctgttgtgcagcgcgtggaat
aaccatcggctgattcaacgtgtgagctttgatatcgcgcactactaccagacgtctgtg
gatgaggctgccagaaaggccggagccgtcgctgtcctgcgtgaagatgcgaggcaatta
gacggctgggcccgcagcggtgaaccgctgcgaatgggcctcggtctgtatcacggcgga
cgtctgcatctgccggtgctggaggccatccggacgtatcggccgctgccgacacccgtg
cagccgtcagcccccgtaccggacgccccgcagacggttcgcctcaacagcatggcgctg
ttcgacaccggccagtccgccctgaagcccggcgccacgaagctgctggtcagcgccctg
gtgggcattaaggccaggcccggctggctgattgtggtcagcggccacaccgacagcacc
ggcagcccgccggtcaatcaggccctctccctgcggcgcgccgaagcggtgcgcgactgg
atgcgcgacaccggcgacgtgccggggagctgcttcgccgtgcagggctacggcgccggc
cgcccggcggcaacgaacgacacccccgaagggcgggcgcagaaccgccgggtcgaaatc
agcctggtgccgcaggcggacgcctgccgggcgccgggcgaaccccccgcgccatcgaag
gatgatggcgcttcacatctcagaggagagtaa

DBGET integrated database retrieval system