KEGG   Pluralibacter gergoviae: LG71_19300Help
Entry
LG71_19300        CDS       T03300                                 

Definition
(GenBank) bifunctional glucose-1-phosphatase/inositol phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
pge  Pluralibacter gergoviae
Pathway
pge00010  Glycolysis / Gluconeogenesis
pge01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LG71_19300
Enzymes [BR:pge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     LG71_19300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: AIR01914
UniProt: A0A089PUL4
LinkDB All DBs
Position
complement(4092709..4093944)
Genome map
AA seq 411 aa AA seqDB search
MKRAAIAAVILSALCAGASAQTAPDGYTLEQVLIMSRHNLRAPLANNGSVLEQSTPRAWP
QWDVPGGQLTTKGGVLEVYMGHYMREWLAQQGMVTTGECPPADSVYAYANSLQRTVATAQ
YFITGAFPGCDVPVHHQPEMGTMDPTFNPVVTDNSAAFSRAAVSAMAAGRAKLHLGDSYR
LLEELVDYRASPACKEKKICSLSEAKDSFSADYQKEPGVSGPLKVGNSLVDAFTLQYYEG
FAPDQVAWGGIKTDRQWRVLSKLKNGYQDSLFTSPEVARNVAAPLVKYIDNALVTEQAKA
PKITLLVGHDSNIASLLMALDFKPYRLHDQYERTPIGGKIVFERWRDGGGNRDLMKIEYV
YQSTKQLRDAAPLTLDAPPQRVTLELKGCPTDSNGFCPIDKFNAVMNTAAK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagcagcgatagcggcggttattttgagtgcactgtgcgcgggcgcctcggcg
caaacggccccggacggctataccctggaacaggtacttatcatgagccgccacaacctg
cgggcgccgctggccaataacggcagcgttcttgaacagtcaacgccccgcgcctggccg
cagtgggatgtgccgggcggacagctgaccactaaaggcggcgtgctggaagtctatatg
ggtcactatatgcgcgaatggctggcgcagcaggggatggtcaccaccggtgagtgtccg
ccggcggacagcgtctacgcctacgccaacagcctgcagcgtacggttgccaccgctcag
tactttattaccggcgcctttccgggctgcgatgttccggttcatcatcagccggagatg
ggcaccatggacccgacctttaatccggtggtgaccgataactccgccgccttcagccgg
gcggcggtcagcgcgatggccgccgggcgggcgaagctgcatcttggcgacagctatcgt
ctgctggaggagctggttgactaccgggcctcgccggcctgcaaagagaagaaaatctgt
tccctgagcgaggcaaaggacagcttcagcgcggactatcagaaagagcccggcgtgtcc
ggcccgctgaaggtgggcaactcgctggtggacgcatttaccctgcaatattacgaaggc
ttcgcgcctgaccaggttgcctggggcggcattaagaccgatcggcagtggcgggtgctg
tccaagctgaaaaacggctatcaggatagcctgttcacctcgccggaggtggcgcgcaac
gtggccgcgccgctggtgaagtatattgataacgcgctggtcaccgaacaggcgaaggcg
ccgaaaattaccctgctggttgggcacgactccaacattgcctccctgctgatggcgctc
gatttcaaaccctaccggctgcacgatcagtatgagcgcacgccgatcggcggcaaaatt
gtcttcgagcgctggcgggacggcggcggcaatcgcgatctgatgaagatcgagtatgtc
taccagagcacgaagcagctgcgcgacgccgcgcccctgacgctcgatgcgcccccgcag
cgggtaactctggagcttaagggctgcccgaccgacagcaacggcttctgcccgattgat
aagtttaatgcggtgatgaatacggcggcaaaatag

DBGET integrated database retrieval system