KEGG   Pluralibacter gergoviae: LG71_21115Help
Entry
LG71_21115        CDS       T03300                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pge  Pluralibacter gergoviae
Pathway
pge00010  Glycolysis / Gluconeogenesis
pge00260  Glycine, serine and threonine metabolism
pge00680  Methane metabolism
pge01100  Metabolic pathways
pge01110  Biosynthesis of secondary metabolites
pge01120  Microbial metabolism in diverse environments
pge01130  Biosynthesis of antibiotics
pge01200  Carbon metabolism
pge01230  Biosynthesis of amino acids
Module
pge_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pge_M00002  Glycolysis, core module involving three-carbon compounds
pge_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LG71_21115 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    LG71_21115 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LG71_21115 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pge04131]
    LG71_21115 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pge04147]
    LG71_21115 (gpmA)
Enzymes [BR:pge01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LG71_21115 (gpmA)
Membrane trafficking [BR:pge04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LG71_21115 (gpmA)
Exosome [BR:pge04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LG71_21115 (gpmA)
  Exosomal proteins of melanoma cells
   LG71_21115 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AIR02248
UniProt: A0A089PQP0
LinkDB All DBs
Position
4511103..4511855
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVGEAKAAGKLLKAEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLTEKELPTTESLAICIDRVVPYWNDTILPRLKSGERVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPVKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaactaagctggtactggttcgccacggcgagagccagtggaacaatgaaaac
cgcttcaccggttggtatgacgttgatctgtccgagaaaggcgttggcgaagcaaaggcg
gcgggcaagctgctgaaggctgaaggcttcagcttcgattttgcttatacctccgtgctg
aaacgtgccatccacaccctgtggaacgtgctggacgagctggatcaggcctggctgccg
gttgagaaatcctggaagctgaacgaacgccactacggcgccctgcagggcctcaacaaa
gccgaaaccgccgagaagtacggcgacgagcaggttaaacagtggcgccgcggcttcgcg
gtaaccccgccggagctgaccaaagacgacgaacgctatccgggccacgatccgcgctac
gcgaagctgacggaaaaagagctgccgaccaccgagagcctggctatctgcatcgaccgc
gtggtgccgtactggaacgacaccattctgccgcgcctgaagagcggcgagcgcgtgatt
attgccgcccacggcaactccctgcgcgcgctggttaaatacctcgacaacatgagcgaa
gacgaaatcctcgagctgaacatcccgaccggcgtaccgctggtgtacgagttcgacgaa
aacttcaagccggtcaaacactactacctgggtaacgctgacgaaatcgccgccaaagcg
gccgccgtggcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system