KEGG   Pluralibacter gergoviae: LG71_21860Help
Entry
LG71_21860        CDS       T03300                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pge  Pluralibacter gergoviae
Brite
KEGG Orthology (KO) [BR:pge00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LG71_21860
Enzymes [BR:pge01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     LG71_21860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like Thi4 FAD_binding_3 DAO K_oxygenase Glutaredoxin AlaDh_PNT_C NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AIR02375
UniProt: A0A1S2B9G0
LinkDB All DBs
Position
complement(4655106..4656671)
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELVATLDDGAKSAEIRELLTEIAELSPKVSFKEDNTLAV
RKPSFLITNPGSMQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDLDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVFVNGQE
FGQGRMTLSEIVAKVDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYEVDVIDSQSASRLTPAAQEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIIVNAQTTEVKGD
GSKVTGIDYRDRVSGDEHHVALSGIFVQIGLLPNTNWLDGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSSFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacactaacatgaagacccagctcaaggcttaccttgagaagctgaccaagccc
gttgagctggttgccaccctggatgacggcgcgaaatcggctgaaatcagagaactgctg
acggagatcgccgagctgtcgccgaaggtgagctttaaagaagacaacacccttgcggtg
cgcaaaccctccttcctgatcactaacccgggctccatgcaggggccgcgctttgccggc
tcgccgctcggccacgagtttacctcgctggtgctggcgctgctgtggaccggcggtcat
ccgtcgaaagaggcccagtctctgctggagcagatccgcgatctcgacggcgacttcgaa
tttgaaacctactactcgctctcctgccacaactgtccggacgtggtgcaggcgctgaac
ctgatggcggtcctcaacccgcgcatcaagcatactgccatcgacggcggcaccttccag
aacgaaatcaccgagcgcaacgtgatgggcgttccggcggtgttcgtcaacggtcaggag
ttcggccagggccgcatgaccctgtctgaaatcgtcgcgaaagtggataccggcgccgaa
aaacgcgcggcggaagagctgaataagcgcgacgcctatgacgtgctgatcgttggctcc
ggccccgcaggcgcggcggctgcagtctactctgcccgtaaaggcatccgcactggtctg
atgggcgagcgctttggcggccaggtgctggataccgtggatattgaaaactacatctcc
gtgccgaaaacggaaggtcagaagctggccggtgccctgaaggcgcacgtctccgactac
gaggtggacgtgattgactcccagagcgccagcaggctgacgcctgccgctcaggaaggc
ggtttgcaccagattgaaaccgcctccggcgcggtgctcaaagcgcgcagcatcatcatc
gctaccggcgccaagtggcgtaacatgaacgtgccgggcgaagatcagtaccgcaccaag
ggcgtgacctactgcccgcactgcgacggcccgctgtttaaaggcaagcgcgtggcggtg
atcggcggcgggaactccggcgttgaggcggccattgacctggcggggatcgttgagcac
gtgactctgcttgagtttgcccctgaaatgaaggccgaccaggtgctgcaggataaagtt
cgcagcctgaaaaatgtcgatatcattgttaacgctcagaccactgaagtgaagggcgac
ggcagcaaagtgaccggcatcgactaccgcgaccgcgtcagcggtgacgagcaccacgtt
gcgctgtccggcatcttcgtccagattggcctgctgccgaacactaactggctggacggc
gctatcgagcgcaaccgcatgggcgagatcatcatcgacgctaagtgcgaaaccagcgtt
aagggcgtattcgccgccggcgactgcaccaccgtgccgtacaagcagattatcatcgct
accggcgagggtgcgaaggcgtctctgagttcctttgattatctgatccgcacgaagacc
gcataa

DBGET integrated database retrieval system