KEGG   Pluralibacter gergoviae: LG71_23475Help
Entry
LG71_23475        CDS       T03300                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
pge  Pluralibacter gergoviae
Pathway
pge00330  Arginine and proline metabolism
pge01100  Metabolic pathways
pge01110  Biosynthesis of secondary metabolites
pge01130  Biosynthesis of antibiotics
pge01230  Biosynthesis of amino acids
Module
pge_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pge00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    LG71_23475
Enzymes [BR:pge01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     LG71_23475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 Shikimate_DH Sacchrp_dh_NADP IlvN GFO_IDH_MocA PDH 3HCDH_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AIR02674
UniProt: A0A1S2BP19
LinkDB All DBs
Position
5011030..5011839
Genome map
AA seq 269 aa AA seqDB search
MDKKIGFIGCGNMGKAILGGLIASGLVQPGQIWVYTPSSEKVAALSEQYGINAAESAQEV
AQIADIVFGAVKPGMMVKVLSEVASSLHKESLVISIAAGITLDQLAGALGHDRKIIRAMP
NTPALVNAGMTSVTPNALATSEDIAEVVTIFRSFGEAEVIAEPMIHPVVGVSGSAPAYVF
MFIEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVMESGSHPGELKDMVCSPGGTTIEAV
RVLEQKGFRAAVIEAMAACMEKSEALSKS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtggataagaaaattggttttatcggctgcggtaacatgggtaaagcgattctcggcggg
ctgattgccagcggcctggtgcagccgggccagatctgggtctatacgccgtcttctgag
aaagtcgccgcgctgagcgaacagtacggaattaatgccgcggagagcgcgcaggaagtg
gcgcagattgcagatatcgtcttcggcgcagtcaagcccggaatgatggtcaaagtgtta
agcgaagtggcgtcaagcctgcacaaagagtctctggttatctctattgccgccggcatc
accctcgatcagctggcaggagcgctgggccatgaccgcaagattatccgcgccatgccg
aacacgccggcgctggttaatgccgggatgacctccgtgacgccaaacgcactggccacc
tcagaagatattgccgaggtggtaaccattttccgcagctttggcgaagccgaagtgatc
gccgaaccgatgatccatccggttgtcggcgtcagcggctcggcaccggcctatgtcttt
atgtttatcgaagcgatggcggatgcggccgtgctgggcggcatgccccgcgcgcaggcc
tataaatttgccgctcaggcggtcatgggctcggcaaaaatggtaatggaatcgggaagt
catcccggtgaactgaaagatatggtctgctccccgggcggcaccactattgaagccgtg
cgcgtgctggagcagaaagggttccgcgcggcggtcattgaagccatggctgcgtgcatg
gagaaatcagaagcgctaagtaaatcctga

DBGET integrated database retrieval system