KEGG   Porphyromonas gingivalis W83: PG_0369
Entry
PG_0369           CDS       T00145                                 

Gene name
coaD
Definition
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
pgi  Porphyromonas gingivalis W83
Pathway
pgi00770  Pantothenate and CoA biosynthesis
pgi01100  Metabolic pathways
pgi01240  Biosynthesis of cofactors
Module
pgi_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:pgi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    PG_0369 (coaD)
Enzymes [BR:pgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     PG_0369 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: AAQ65578
UniProt: Q7MX47
LinkDB
Position
403350..403811
AA seq 153 aa
MKKNIALFAGSFDPFTRGHADIVERSLAIFDEVIIAIGINEQKRTLFSAERRQEQIARYY
ASRPAIGVITYSGLTVDLVRQTGATALVRGIRSGSDFEYERTLADLNRHLSGVDTVLLCT
DTRLSFISSSAVRELISFGRDVSDFLPEGFVLD
NT seq 462 nt   +upstreamnt  +downstreamnt
atgaaaaagaatatcgccctctttgccggttcgttcgaccctttcacacgcggccacgcc
gacatcgtcgaacgctcgctggccatattcgatgaggtgatcatcgctatcggcatcaat
gaacagaagcgcacgctcttctccgcagaacggcgacaagagcagatagcccgctactat
gcttcccgacctgctatcggggtgattacttatagtgggcttacggtcgatctcgtgcgc
caaaccggagccactgctttggtgcgaggtattcgttcaggatctgattttgagtacgag
cgtactttggccgacctgaatcgtcatctttcgggagtggataccgttctgctttgtacc
gacacgcgtctctctttcatcagctcgagtgccgtacgcgagttgatctcctttggacga
gacgtctcggatttcctgccggaggggtttgtcctcgattaa

DBGET integrated database retrieval system