KEGG   Porphyromonas gingivalis W83: PG_0387Help
Entry
PG_0387           CDS       T00145                                 

Gene name
tuf
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
pgi  Porphyromonas gingivalis W83
Brite
Translation factors [BR:pgi03012]
 Eukaryotic Type
  Elongation factors
   PG_0387 (tuf)
 Prokaryotic Type
   PG_0387 (tuf)
Mitochondrial biogenesis [BR:pgi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PG_0387 (tuf)
Exosome [BR:pgi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PG_0387 (tuf)
  Exosomal proteins of breast cancer cells
   PG_0387 (tuf)
  Exosomal proteins of colorectal cancer cells
   PG_0387 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: AAQ65593
UniProt: F5HDQ9
LinkDB All DBs
Position
420783..421970
Genome map
AA seq 395 aa AA seqDB search
MAKEHFNRSKPHVNVGTIGHVDHGKTTLTAAITTVLAKRGLSELRSFDSIDNAPEEKERG
ITINTSHVEYQTANRHYAHVDCPGHADYVKNMVTGAAQMDGAIIVVAATDGPMPQTREHI
LLARQVNVPRLVVFMNKCDMVDDEEMLELVEMDMRELLSFYDFDGDNTPIIRGSALGALN
GEPQWEDKVMELMEAVDNWVPLPERDIDKPFLMPVEDVFSITGRGTVATGRIETGIVKTG
DEVQIIGLGAEGMKSVVTGVEMFRKILDEGQAGDNVGLLLRGIDKDQIKRGMVISHPGKI
TPHKRFKAEVYILKKEEGGRHTPFHNKYRPQFYIRTLDVTGEITLPEGTEMVMPGDNVTI
TVELIYPVACNVGLRFAIREGGRTVGAGQITELID
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagagcattttaacagatcgaaaccccacgttaacgttggtacgatcggacac
gtggaccacggtaagactaccttgacggctgcaatcacaactgtgttggcaaagaggggt
ctttcagaactccgttcatttgattcaattgataacgctcccgaagaaaaggaacgtggt
atcacgattaatacttcacacgttgaataccaaacagctaatcgtcactacgctcacgta
gactgtccgggtcacgccgactatgtgaagaacatggttaccggtgctgctcagatggac
ggtgctataatcgttgtagcagctacagacggccctatgcctcagactcgcgagcacatc
cttttggctcgtcaggtaaacgttcctcgtctggttgttttcatgaacaaatgtgacatg
gtagacgatgaagagatgctcgagcttgttgaaatggacatgcgcgaactcctttctttc
tacgatttcgatggtgacaatacccctatcatccgtggttctgctctgggcgctttgaat
ggagagcctcagtgggaagacaaggtgatggagcttatggaagctgttgacaactgggtt
cccctgccagagcgcgatatcgacaaaccgttcttgatgccggttgaagacgtgttctct
atcacgggtcgtggtacggttgctacaggacgtatcgaaaccggtatcgtgaagaccggt
gacgaagttcagatcatcggcctcggtgcagaaggaatgaagtcggttgttacgggtgtt
gaaatgttccgtaagattcttgacgaaggtcaggctggtgacaacgttggtctcctcctg
cgtggtatcgataaggatcagatcaagcgtggtatggttatctctcacccgggtaagatt
actcctcacaagagatttaaggccgaggtttatatcttgaagaaagaagaaggtggtcgc
cacactcctttccacaacaaatatcgtccgcagttctacatccgtacgcttgacgtgacc
ggtgaaatcactcttcccgaaggaacagaaatggttatgcccggtgacaacgtaacgatc
actgtagaactcatctacccggttgcatgtaacgtaggtctccgcttcgctatccgtgaa
ggtggtcgtacggtaggtgccggtcagattacagagctcatcgactaa

DBGET integrated database retrieval system