KEGG   Porphyromonas gingivalis W83: PG_0619Help
Entry
PG_0619           CDS       T00145                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pgi  Porphyromonas gingivalis W83
Brite
KEGG Orthology (KO) [BR:pgi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PG_0619
Enzymes [BR:pgi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PG_0619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like GIDA FAD_binding_2 Thioredoxin_3 FAD_oxidored NAD_binding_8 NAD_binding_7 Thi4 DAO FMO-like Lycopene_cycl AlaDh_PNT_C DUF2190 K_oxygenase FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AAQ65803
UniProt: Q7MWJ1
LinkDB All DBs
Position
671244..672791
Genome map
AA seq 515 aa AA seqDB search
MLDKDTLAQVGSYFAQLKKSYTLRLNAHTSHPSYNEAKEMLDGLASVSDHVRAEYNAADD
FRIDLLVDGADSGIGFRGIPGGHEFSSLLLAILNNDGIGRNIPDEGVQDRIRRINGPIEL
KTYVSLSCTNCPDVVQTLNMIAILNPTINHTMVDGSFFPDEVESLGIASVPTVMAGDEVI
HVGRGDMAALLNKIEAKYGSVPAESADKTLRPFDLLVVGGGPAGSAAAIYSARKGLKVAI
VAERVGGQVNETVGIENLISVPYTTGSELASNLNSHIKANTISLFEARTVSSITQQEGIS
RVEVTSGEVFTAPALIMATGASWRKLGVPGEKEYTGNGVAYCAHCDGPFFKGKRVAVVGG
GNSGLEAAIDLAGICEHVTVVEFLDVLRADEVLQKKARETANIDILLSTATKEIMGNGQK
VEGILLTDRNTGEEKQIALSGVFVQIGLAANTSLVKDLVETNSRGEVLIDTSCRTNTPGI
YAAGDCTTVPYKQIVIAMGEGAKAALSAFEDRIRG
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgcttgataaagatactcttgcccaagtgggttcttactttgcccaactgaaaaagtcc
tatacattacgactcaatgctcatacgtctcatccttcctacaacgaggcgaaggaaatg
ctcgatgggcttgcatccgtttcggatcatgttcgtgcggaatacaatgcggcagatgat
tttcgtatcgatctgctcgtagacggagcggatagcgggatcggcttccgtggtatcccg
ggtggccatgaatttagctcactgcttcttgctattctcaacaatgacggtatcggaagg
aatatccccgatgaaggagtacaggatagaatccgccgtatcaatgggccgatagagctg
aaaacctatgtatccctctcttgtacgaattgtcccgatgtggtgcagaccctcaatatg
attgccattctcaatccgactatcaatcacaccatggtcgatggttctttcttcccggac
gaagtggagtcgttgggcatcgcttccgttccgacggttatggccggagatgaagtgatc
catgtggggcgtggcgatatggctgccttgctgaacaagatagaagccaaatatggctct
gtccctgccgagtcggcagataagacgctgcggcctttcgacctccttgtcgtgggcggt
ggcccggccggatcggctgcagccatctattctgctcgtaaggggctgaaggtagccatc
gtagccgaacgggtaggcggccaagtaaacgaaacggtcgggatcgagaacctgatttcc
gtgccttacaccacaggatcggaacttgcatccaacctcaattctcacatcaaggccaat
acgatctccctcttcgaggcccgaaccgtgtcgtccatcacacaacaagaaggtatatcc
cgtgtggaagtgacttccggagaagtcttcacggctccggctcttatcatggctacgggt
gcttcatggcgcaagctcggtgtacccggcgagaaagaatatacgggtaatggtgtagcc
tactgcgctcactgcgatgggcctttcttcaaaggcaagcgtgtggccgtggtcggtgga
ggcaactccggtctggaagctgccatcgatttggccggtatatgcgagcatgtcactgta
gtagagtttctggatgtgctcagggctgatgaggtgcttcaaaagaaagcacgtgaaacg
gccaatatcgacatcctcctcagtactgctaccaaagaaatcatgggcaacggacagaaa
gtggagggaatactgcttaccgatcgcaacacgggagaggaaaagcaaatcgcactcagt
ggcgtattcgtacagatcggtcttgccgccaatacatcccttgtgaaagatttggtggaa
acaaacagccgaggcgaagtactcatcgatacttcatgccgtaccaatacgcccggcata
tatgctgcaggtgactgtaccactgtgccctacaaacagatagtcattgccatgggcgaa
ggagccaaagctgctctttctgctttcgaggatcgcatccgtggctga

DBGET integrated database retrieval system