KEGG   Porphyromonas gingivalis W83: PG_1097Help
Entry
PG_1097           CDS       T00145                                 

Definition
(GenBank) Mur ligase domain protein/alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
K01929  UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
pgi  Porphyromonas gingivalis W83
Pathway
pgi00300  Lysine biosynthesis
pgi00473  D-Alanine metabolism
pgi00550  Peptidoglycan biosynthesis
pgi01100  Metabolic pathways
pgi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pgi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    PG_1097
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PG_1097
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PG_1097
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    PG_1097
Enzymes [BR:pgi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     PG_1097
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     PG_1097
Peptidoglycan biosynthesis and degradation proteins [BR:pgi01011]
 Precursor biosynthesis
  Amino acid ligase
   PG_1097
  Racemase
   PG_1097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase
Motif
Other DBs
NCBI-ProteinID: AAQ66208
UniProt: Q7MVG7
LinkDB All DBs
Position
1163097..1165568
Genome map
AA seq 823 aa AA seqDB search
MFLFSELCRRLSPDAVRIVSDHRIVHLLTDSRTLSEPATTLFFALRTTSGDGHLYIRDLY
DRGVRSFVISDPSKDLMEKMPQANWMRVAHPLDALQRIAALRRSMFDIPVIGITGSNGKT
IVKEFLYQLLRKDYRIVRSPRSYNSQIGVPLSVWQMAEEHTLGIFEAGISQMGEMERLES
IICPSYGIITNIGGAHQENFPDIKTKLEEKLRLFLHCHTIVYNGDCEEIAAAISFCGLAR
AGVSWSRTKPEAHLYVCRLESKDNRTEIDFRCLGKDYSLVLPFTDAASIEDIIHCITLIS
VLCPEVLSARKRFAGLEPVEMRMEVKAGDHGNTIINDVYSNDVYSLTLALDFQRRRTAET
CLKKVLILSDILQSGMPPEELYRHVAGQLQVYALDFFVGIGEEIASHRTCFAGMSAVFFK
DVATFLTSGEIERFSNSCILLKGARKYRFEQITERLVQQVHETALRINLSAIIHNLNFYR
NLVPSGTKTICMVKAQGYGVGSYELVKTLQEHRVDYIAVAVADEGKELRERGIGMPIVVM
NPQRNAFQTLIDYGLEPEIYSFALLASFSETVVRNGLVGYPVHIKIDTGMHRLGFLPSDM
TRLGEILAKDAGLSIRSVFTHLAGADDPDLDDFTRSQLLSFDAAFASLSSLLGYIPLRHV
LNTAGVERFADYHADMIRLGIGLYGVTASGVQGLRPVATLMTTILQIKDISSSDTVGYGR
KGRVQQPSRIAIIPIGYADGLDRRLSCGVGEVLVRGHRCPIVGNVCMDICMIDVTGMPAE
EGDPVVVFGEELPIEEVARKMNTIPYEVLTGISPRVRRVYFQE
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttttctccgaactatgcagacgtttatcccctgatgcggtaagaatcgttagc
gatcaccggatcgtccatttgcttaccgatagccgtacgctgtccgaacctgctactact
ctcttcttcgccttacgcaccacatcgggcgatggccatttgtatattcgagatctatat
gatagaggagtaaggagttttgtcatttcggatccctccaaagatttgatggagaaaatg
ccgcaagcgaattggatgcgcgtggctcatccgttggacgctctacaacggatagccgca
ctaaggcgttctatgttcgatattcctgtgataggaattaccggaagcaatggcaagaca
atcgtcaaagagttcctttatcagttattgcgcaaggactatcgcattgtccgctcgccc
cgaagctataactcgcagataggagtacccctttccgtatggcaaatggcggaggaacac
actctcggtatatttgaggccggcatatcgcaaatgggggaaatggaacgtttggagagc
ataatatgcccctcgtatggtatcattacgaatataggaggtgctcatcaggagaacttc
ccggatataaaaacgaaactggaggaaaagctccgcttgtttctccattgtcatactatt
gtctataacggcgactgcgaagagatagctgctgctatctctttctgcggtttggcaaga
gccggagtttcatggagccggacgaagcccgaagctcatttgtatgtgtgcagattggaa
tcgaaagataatcgcaccgagattgattttcgctgtctcggcaaagattattctcttgtg
ctaccattcacagatgctgcttccatagaagatatcatccattgcatcacgctgatttct
gtactgtgtccggaggtcttatctgctcgaaagcggtttgcaggtttagagcctgtagaa
atgcgaatggaggttaaggccggagatcatggcaatacgatcatcaatgacgtttacagt
aatgatgtctattcgctcacgctggccttggacttccaacgaagacgtactgccgaaaca
tgcctaaagaaagtgttgatactgtccgacatcttgcaaagcggaatgcctcccgaagaa
ttgtacaggcatgtggcaggacaattacaagtctatgcccttgactttttcgtcggcatc
ggagaggaaatagcctcgcatcgcacttgttttgccggcatgtctgccgtttttttcaaa
gatgttgctacattcttgacatccggtgagatagagcgcttctccaacagctgtattctg
ctcaaaggtgcacgcaagtatcgcttcgaacagattacggagcgacttgtacaacaggtg
cacgaaactgcgctaaggatcaatctgtcagctatcatccataatcttaatttctatcgg
aatttagttccatcaggcaccaaaaccatctgcatggtcaaggctcagggatatggcgta
ggctcctacgaacttgtcaaaaccctgcaggagcatcgtgtggattatatagctgtagcc
gtagcggacgaaggcaaagaactaagagagcgaggtatcggtatgcctatcgtggtcatg
aacccccaaaggaatgcctttcagacactcatagactacggattagagcctgagatttat
agctttgcccttctcgcttctttttcggaaacggtcgtacgcaacggccttgtgggctat
cctgttcatatcaaaatcgacacgggaatgcatcggcttggttttttaccgtctgatatg
acacgactcggtgagattcttgccaaagatgccggactgagcattcgctctgtatttacc
catcttgcaggtgccgacgatcctgatttggatgattttacgcgatctcaactgctgtct
ttcgatgctgctttcgcctctctctcctctttattaggctatatacctctccgtcatgta
ttgaatacggcaggggtagagcgttttgccgactaccatgccgacatgattcgtcttggc
atcggcttgtatggagtaacggcatccggcgtacaaggattgagaccggtagccaccctg
atgactacaattttgcagatcaaggatatttcttcgagcgatacggtcggatatggacgt
aaaggacgggtacaacaaccatctcgaatagctattatacctatcggttatgccgatggc
ttggatagacgtttgagttgtggagtaggagaagtacttgtgcgtggacatcgctgtcct
atagtagggaatgtctgtatggatatctgtatgatagatgttaccggtatgccggcagaa
gagggagaccctgtcgttgtattcggagaagaactcccgatcgaagaagttgcccgtaag
atgaatactatcccctatgaggtgctcacgggtatctcgcctcgtgttcgcagagtttat
ttccaagagtag

DBGET integrated database retrieval system