KEGG   Phaeobacter inhibens 2.10: PGA2_239p0500Help
Entry
PGA2_239p0500     CDS       T02193                                 

Definition
(GenBank) putative ATP dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
pgl03030  DNA replication
pgl03410  Base excision repair
pgl03420  Nucleotide excision repair
pgl03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PGA2_239p0500
   03410 Base excision repair
    PGA2_239p0500
   03420 Nucleotide excision repair
    PGA2_239p0500
   03430 Mismatch repair
    PGA2_239p0500
Enzymes [BR:pgl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PGA2_239p0500
    6.5.1.6  DNA ligase (ATP or NAD+)
     PGA2_239p0500
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PGA2_239p0500
DNA replication proteins [BR:pgl03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PGA2_239p0500
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PGA2_239p0500
DNA repair and recombination proteins [BR:pgl03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PGA2_239p0500
   NER (nucleotide excision repair)
    Other NER factors
     PGA2_239p0500
   MMR (mismatch exicision repair)
    Other MMR factors
     PGA2_239p0500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N Cation_efflux
Motif
Other DBs
NCBI-ProteinID: AFO89477
LinkDB All DBs
Position
pPGA2_239:complement(57093..58649)
Genome map
AA seq 518 aa AA seqDB search
MQAFAELLEQLAFTPSRNGKIAHLTTAFATIPDPERGYALAAITGDLALRNVTPSLLRGL
VAEETDPELFRLSYDFVGDLAETVALIWQHSDTVIDLSLTDAVHELTNTAKAQLPALIAL
RLSQMTPTQRYAYLKLATGGLRVGVSARLARGALAQFGDVDVTEIEELWHGLTPPYLPLF
AWLEGGEKPVNLAAAPFRPVMLSTGTDLEDLASLSPADFIAEWKWDGIRVQAVNDKGTRR
LYSRTGEDISGSFPDVIEALNFDGVLDGELLVKRGDSVAPFGDLQKRLGRKKVGKAMLAS
HPAALRVYDVLYWNGEDLRPRTLADRQIHLKTCISDLRDPRIDLSLPLGFETWEDLEKLR
ADPPNSVIEGVMIKRRDSAYIAGRKRGYWFKWKRDPMLVDAVMLYAQRGHGKRSGYYSDF
TFGVWNDDQLVPVGKAYFGFTDAELKELDRFVRNNTIDRFGPVRAVKPELVLEVAFEGLN
ESSRHKSGLAMRFPRINRIRTDKPALEAGTLAELRAFL
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccttcgccgaacttttggaacagcttgccttcacaccgtcgcgcaatggcaag
atcgcgcatctgacgaccgcgtttgccaccatcccggaccccgaacggggctatgcgctt
gcggccatcaccggtgaccttgccctgcgcaacgtaacgccctcgctgctgcgcggtctg
gtggcagaggaaacggacccagagttgttccgcctgtcctatgattttgtcggcgatctc
gcggaaaccgtagcccttatctggcagcactcagacacggtgattgatctgtcgctaact
gacgcggtgcatgagttgaccaacaccgccaaggcacagctccccgcactcatcgctctg
cgattgtcccagatgaccccgacgcagcgttacgcctatctgaaattggcgacgggtggt
ctgcgcgttggggtctctgcccggttggcacgcggcgccttggcccaatttggggatgtt
gatgtcactgagatagaagagctctggcacgggctgacgccaccatacctgccccttttt
gcttggttagagggtggcgaaaaaccagtgaaccttgccgctgcacccttccgcccggtc
atgctatccaccggcaccgatctggaagacctcgccagtctctccccagcagacttcatc
gcggaatggaaatgggacggcatccgtgttcaggccgtgaatgacaagggcaccagacga
ctgtattcacgcaccggtgaagatatctccgggtccttccccgatgtgatcgaggcgttg
aattttgacggggtgctggatggtgagctgctggtaaagcgcggagacagcgttgcccca
tttggcgatctgcagaaacggctggggcgcaagaaggttggaaaagcgatgctcgcaagc
catcccgccgcgctgcgggtctatgacgtgctgtactggaatggcgaagatctgagaccc
cgcaccctggctgatcgccagatccatctgaaaacctgcattagcgatctgcgtgatccg
cgtattgacctctccctgccgcttggctttgaaacttgggaagatctggagaaactgcgc
gcggatccaccaaacagcgtgatagaaggcgtcatgatcaagcgccgcgacagcgcctat
attgcagggcgcaagcgcggctactggttcaaatggaaacgggatccgatgcttgtggat
gcggtcatgctttatgcacagcgcgggcatggcaagcgttcaggctactactccgatttc
acctttggcgtgtggaatgacgatcagctggtgcctgtcggcaaggcgtatttcggcttt
accgacgctgagctgaaggagctggatcggtttgtacgcaacaataccattgatcgcttt
ggtccggttcgtgcggtgaaacctgagcttgttttggaagttgccttcgaagggctgaat
gaatcatcccgccacaaaagtggtctagccatgaggtttccccgtatcaatcgcatacga
accgataaaccagcgttagaagcaggaacgttggctgagctgagagcgtttctttaa

DBGET integrated database retrieval system