KEGG   Phaeobacter inhibens 2.10: PGA2_c03170Help
Entry
PGA2_c03170       CDS       T02193                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component SucA
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
pgl00020  Citrate cycle (TCA cycle)
pgl00310  Lysine degradation
pgl00380  Tryptophan metabolism
pgl01100  Metabolic pathways
pgl01110  Biosynthesis of secondary metabolites
pgl01120  Microbial metabolism in diverse environments
pgl01130  Biosynthesis of antibiotics
pgl01200  Carbon metabolism
Module
pgl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pgl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PGA2_c03170 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    PGA2_c03170 (sucA)
   00380 Tryptophan metabolism
    PGA2_c03170 (sucA)
Enzymes [BR:pgl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     PGA2_c03170 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AFO86337
LinkDB All DBs
Position
complement(348603..351560)
Genome map
AA seq 985 aa AA seqDB search
MTDQSPNELFHASSFMQGHNAEYLEQLYAQYANDPNAVDAAWAEFFRQMGDAELDVKAEA
AGPSWARADWPPAPNDDLTGALTGEWPAPAEAKGAGKKIKEQAAAKGVEVTDDQVQRAVL
DSIRALMLIRAYRIRGHLAANLDPLGMREEAQHPELDPRTYGFTEADMDRPIFIDNVLGL
QVASMRQIVSIVKRTYCGTFALQYMHISDPEQASWLKERIEGYDKEITFTREGRKAILNK
MVEAEGFEKFLHVKYMGTKRFGLDGGESLIPAMEQIIKRGGALGIRDIVIGMPHRGRLSV
LANVMQKPYKAIFNEFQGGSFKPEDVDGSGDVKYHLGASSDREFDGNSVHLSLTANPSHL
EAVNPVVLGKVRAKQDQLKDSERTKVLPILLHGDAAFAGQGVVAECFALSGLRGHKAGGT
MHIVVNNQIGFTTAPHFSRSSPYPTDNALVVEAPIFHVNGDDPEAVVHAARVATEFRQKF
HKDVVLDIFCYRRFGHNEGDEPMFTNPLMYKKIKGHKTTLSLYTERLVKDGLIPEGEIED
MKASFQARLNEEFEAGKNFKPNKADWLDGRWSHLDKKDTDYQRGQTSVSPETFKEVGTAL
SRVPEGFPVHKTIGRFLDARAKMVDSGEGIDWATGEALAFGSLLTEGYPVRLSGQDATRG
TFSQRHSGIVNQNTEERYYPLNNIRSGQSHYEVIDSALSEYAVLGFEYGYSLAEPNALTL
WEAQFGDFANGAQIMFDQFISSGESKWLRMSGLVCLLPHGFEGQGPEHSSARLERFLQMC
GQDNWIVANCTTPANYFHILRRQLHRTFRKPLIMMTPKSLLRHKLAVSKAEEFTTGSSFH
RVLWDDAQHGNSDIKLVADDKIKRVVLCSGKVYYDLLEERDARGLDDVYLMRIEQYYPFP
AISLVKELERFKGAEVVWCQEEPKNQGAWSFIEPNIEWVLTRIGAKHSRPTYVGRATSAS
PATGLASEHKAQQAALVNEALSIEG
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccagagccctaacgaactcttccatgcctcctccttcatgcaggggcacaat
gctgagtatcttgagcagctctatgcccaatacgccaacgaccccaacgcggtggatgcc
gcctgggctgagttctttcggcagatgggtgacgcagaacttgatgtgaaggcggaggcc
gctggcccctcctgggcgcgcgctgactggccgcctgcccccaatgatgatctgacaggc
gcgctgaccggcgagtggcctgccccggcagaggccaagggtgccggcaagaagatcaag
gaacaggctgccgccaagggcgtcgaagtaaccgatgaccaagtgcagcgcgctgttctg
gattcgatccgggccttgatgctgatccgggcctaccggatccgcggccatctggcagct
aatctcgatccgctcggtatgcgcgaggaggcccagcatcccgaactggatccgcgcacc
tatggtttcaccgaagctgacatggaccgcccgatcttcatcgacaacgtgctggggctt
caggtcgcctcgatgcgccagatcgtcagcatcgtgaagcgaacctactgcggcaccttc
gcactgcaatacatgcacatctctgatcccgaacaggccagctggctgaaggagcggatc
gagggttatgacaaggaaatcaccttcacccgcgaaggtcgcaaggcgatcctcaacaaa
atggttgaagcagagggcttcgaaaaattcctacacgtcaaatacatgggcaccaaacgc
tttggtcttgatggtggcgaaagcctgattccggcgatggagcagatcatcaaacgcggc
ggtgcgctggggatccgcgatatcgtcatcggcatgccgcaccggggccgtctctcggtg
ctcgccaatgtgatgcagaaaccctacaaggcgatcttcaatgaatttcagggcggcagc
tttaagcccgaggatgttgatggctcgggcgatgtgaaatatcacctcggcgcctcatct
gaccgcgaatttgacggcaactccgttcacctgtcattgaccgcgaacccctcgcacctt
gaggccgtaaacccggttgttcttggcaaggttcgcgcaaagcaggaccagctcaaggac
agcgaacgcaccaaggtgctgccgattctgctgcacggtgatgcggcctttgcgggtcag
ggtgttgtagccgagtgctttgctctctcgggcctgcgcggtcacaaggccggcggcacc
atgcatatcgtggtgaacaaccagatcggtttcaccacggcgccgcatttctcgcgctct
tcaccttaccccaccgacaacgcgctggtggtcgaggcaccgatattccacgtcaacggc
gacgatccggaagccgtggttcacgccgccagggtcgccaccgaattccgccagaagttc
cacaaggatgtcgttctcgatatcttctgctaccgccggtttggccataacgagggcgac
gagcccatgttcaccaacccgctgatgtacaagaagatcaagggccacaagacaacgctg
tcgctttatactgagcgtctggtcaaggatggcctgattcccgagggggagattgaggat
atgaaagcctcattccaggcccgtctgaatgaggaattcgaagccggcaagaacttcaag
ccgaacaaggcggactggctggatggccgctggtcgcacctcgacaagaaggataccgat
taccagcgcggccagacctctgtatcgccagaaaccttcaaggaggtcggcaccgctctc
agccgagtgcccgagggcttccccgtccacaagaccattggtcgtttcctggacgcgcgc
gccaagatggtggatagcggcgaaggaatcgactgggcaactggcgaggcgctggccttt
ggctctcttctgaccgaaggctatccggtgcgcctgtccgggcaggatgccacgcgcggc
accttctctcagcgccattcaggcatcgtcaaccagaacaccgaggagcgttactatccg
ctgaacaatatccgcagcggccagtctcattatgaggtgatcgactcggcactgtccgaa
tacgcagttctcggctttgaatacggctactcgctggcggaaccgaacgcgctgaccctg
tgggaggcccagttcggcgacttcgccaacggcgcccagatcatgttcgaccagttcatc
tcctcgggtgaatcgaaatggctgcgaatgtcgggcctcgtctgcctgctgccgcacggt
tttgaaggccaggggccggagcactcctccgcccgtctggagcgcttcctgcaaatgtgc
ggccaggacaattggattgtcgccaactgcaccacaccggcgaactacttccacatcctg
cgccgccagctgcaccgcaccttccgcaagccgctcatcatgatgacgccaaagtcgttg
ctgcgacacaaattggcagtcagtaaggccgaagaattcaccaccggttcgagcttccac
cgggttctctgggatgatgcccagcacggcaattccgacatcaaactggtcgccgatgac
aagataaaacgcgtcgtcctctgctcgggcaaggtctactacgacctcctggaagaacgc
gacgcccgtggtctcgacgatgtgtacctgatgcggatcgaacaatattacccgttccct
gccatctcgctcgtgaaggagcttgagcgcttcaaaggtgctgaggtggtgtggtgtcag
gaggagcccaaaaatcagggcgcctggagcttcatcgaaccgaatatcgaatgggtgctg
acgcgcatcggcgccaagcacagccggccgacctatgtcggtcgcgccacctcggcttcg
cccgcaacgggcctggccagcgaacacaaagcccaacaagctgcgctcgtgaacgaagcg
ctgagcatcgaaggataa

DBGET integrated database retrieval system