KEGG   Phaeobacter inhibens 2.10: PGA2_c22670Help
Entry
PGA2_c22670       CDS       T02193                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase Tdk
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
pgl00240  Pyrimidine metabolism
pgl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    PGA2_c22670 (tdk)
Enzymes [BR:pgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     PGA2_c22670 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: AFO88256
LinkDB All DBs
Position
2507795..2508394
Genome map
AA seq 199 aa AA seqDB search
MAKLYFHYSTMNAGKSTVLLQASHNYRENDMDTYLLTAALDDRAGQGRIASRIGIGAEAD
MFRPGENLYDKVSNRLAKGAVASIFVDEAQFLSPDQVWDLARVVDDLRVPVLCYGLRVDF
QGKLFPGSATLLALADEMREVRTICHCGKKATMVIRQDENGQTITEGAQVQIGGNETYLS
LCRRHWRQATGDLPAEKSD
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctactttcactactccaccatgaatgccggcaaatcgacggtgctcttg
caagcctcgcataactaccgcgagaacgatatggacacctatctgctgaccgcggcgctg
gatgatcgcgccggtcagggacggatcgcctcgcgcatcgggattggtgcggaggcggat
atgtttcgccccggcgagaacctgtatgacaaggtaagtaaccgtctagccaagggcgca
gtcgccagtatctttgtcgatgaggcgcagtttctgtcaccggatcaggtctgggatctg
gcacgggtggtggatgatctgcgggtgccggtgctgtgctacgggctgcgggtcgatttt
cagggcaagctgtttccgggatcggcgacgctgctggcgctcgccgatgaaatgcgtgag
gtccgcaccatctgccactgcggcaagaaggccactatggtgatccggcaggacgaaaat
ggccagaccatcaccgagggcgcgcaggtgcagatcggcggcaacgagacctatctgtcg
ctctgcaggcggcattggcgtcaggccacgggcgacctgcctgcggagaagtctgactga

DBGET integrated database retrieval system