Phaeobacter inhibens 2.10: PGA2_c22930 Help Entry PGA2_c22930       CDS       T02193                                  Symbol groS Name (GenBank) chaperonin GroS   KO K04078   chaperonin GroES Organism pgl  Phaeobacter inhibens 2.10 Brite KEGG Orthology (KO) [BR:pgl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pgl03110]     PGA2_c22930 (groS)    03029 Mitochondrial biogenesis [BR:pgl03029]     PGA2_c22930 (groS) Chaperones and folding catalysts [BR:pgl03110]  Heat shock proteins   HSP10    PGA2_c22930 (groS) Mitochondrial biogenesis [BR:pgl03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     PGA2_c22930 (groS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  AFO88282 UniProt:  A0AA85Z5D0 LinkDB All DBs Position complement(2531291..2531578) Genome browser AA seq 95 aa AA seqDB search MALKPLHDRVLVRRTESEEKTAGGLIIPDSAKEKPSEGQVVATGEGARKDSGELIAMAVS AGDKILFGKWSGTEVTVDGEELLMMKESDIMGIIE NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggcattgaaaccgcttcatgaccgcgtgctggtccgtcgcaccgaaagcgaagaaaaa accgctggtggtctgatcatccctgattccgccaaggaaaagccgagcgaaggccaagtg gtcgcaaccggcgaaggcgcacgcaaggacagcggcgagctgatcgcgatggctgtttcc gcaggcgacaagatcctgttcggcaaatggtcgggcactgaggtcaccgtcgatggcgaa gagctgctgatgatgaaagaaagcgacatcatgggtatcatcgagtaa

DBGET integrated database retrieval system