KEGG   Paenibacillus graminis: PGRAT_03060Help
Entry
PGRAT_03060       CDS       T03325                                 

Definition
(GenBank) sodium ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
pgm  Paenibacillus graminis
Brite
KEGG Orthology (KO) [BR:pgm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pgm02000]
    PGRAT_03060
Transporters [BR:pgm02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    PGRAT_03060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 SMC_N SbcCD_C AAA_22 AAA_29 MukB AAA_30 DUF3584
Motif
Other DBs
NCBI-ProteinID: AIQ66740
UniProt: A0A089M2W3
LinkDB All DBs
Position
659973..660875
Genome map
AA seq 300 aa AA seqDB search
MEALKLEQVVKQYGDKTAVNGISLKVERGEIYGLLGANGAGKTTTMRMVLGLIYPDGGKI
LYNGKPFSDELQHMMGYLPEERGLYPKVKVSDQIIYLARLRGMSAGDAEKSLRFWLERFD
VPEYYNKKIEELSKGNQQKMGFIAAVVHKPQILILDEAFSGLDPVNVELLKDTVKELRDQ
GTSILFSTHRMEHVEELCRNITILDRSNTVVQGDIREIKKGYPREEVALRTAGDLSGLDK
IPGVSAVQKQERGYLLSISEIGAAQRILQYAMAAGEVEHFEIKEPTLNQIFIRAVGESNE
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggaagctttgaagctggaacaagttgtgaagcagtatggagacaaaaccgcagtaaat
ggaatcagcctaaaggtggagcgaggtgagatttatggactgctcggcgccaacggtgcc
ggcaaaactacgaccatgcgtatggtgctgggactgatctatcccgatggaggaaagatt
ctatataacggcaaaccgttcagcgatgagctgcagcatatgatgggatatctcccggag
gaacgggggctgtacccgaaggtaaaggtcagcgaccagattatctatcttgcccggctg
cgcggcatgtcagccggtgatgcggagaagagcctccgcttctggctggaacgttttgac
gtcccggagtattacaacaagaagatcgaagagctctccaagggcaaccagcagaagatg
ggctttatcgccgcggttgtacataagccgcaaatcctgatcctggacgaggcgttcagt
ggtctggaccccgtcaacgttgagctgcttaaggatacagtaaaagaattgcgtgaccag
ggcacgagcattctgttctccacccaccggatggagcatgtggaagagctgtgccgcaat
attacgattctcgaccgttccaatacggtcgtgcaaggcgacattcgtgagatcaagaag
ggttatccgcgtgaagaagtcgcgctcaggacggccggcgatttgagcggactggacaag
attccaggggtaagcgcggttcagaagcaggagcgggggtatctgctctccatcagcgag
atcggtgcagcgcagcgtatcctgcaatacgcgatggcagccggtgaagttgaacatttt
gaaatcaaggaaccaaccttgaaccaaatctttatcagagcggtgggtgaatctaatgaa
taa

DBGET integrated database retrieval system