KEGG   Paenibacillus graminis: PGRAT_03430Help
Entry
PGRAT_03430       CDS       T03325                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pgm  Paenibacillus graminis
Brite
Enzymes [BR:pgm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PGRAT_03430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF2935
Motif
Other DBs
NCBI-ProteinID: AIQ66805
UniProt: A0A089M336
LinkDB All DBs
Position
complement(728463..729641)
Genome map
AA seq 392 aa AA seqDB search
MPDLYGQVLPVRILEEIAFWKKQEQEHTVVIKAVIPQLEERYVKLLDEWAIVFGATEQAA
RQLLEASQGCSPAELAAGTEQLLQVACSQSREFIRQLYALMEGSAAVKAHPLAGTVLLHI
IRESEYVLGVLSALTLTGNAPLWMREDIAPQSGAADEHKPKDSQTGPGPQVPLILQSSGI
REQGTVPIGGHTLPPLPYAYNALEPYIDEKTMRIHHDKHHQSYVDGLNKAEKKLAEARKT
KDFDLVKHWERELAFNGAGHYLHTIFWNVMSPQGGGRPTGALLDAIEHSFGSYEAFKEQF
TEAANKVEGGGWAILVWSPRSHRLEILTAEKHQNLSQWDVVPLLALDVWEHAYYLKHQNN
RADYIKDWWKVVNWPYVSERFNAARKLVWQPF
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgccggatctatacgggcaagtgctgccagtgcgtattctcgaagaaattgcattctgg
aaaaaacaggagcaggagcatacggtagtcatcaaggcggttatccctcagcttgaagag
cggtatgtgaagctgctcgacgaatgggctattgtcttcggggctaccgagcaggcggcc
cgccagttgcttgaggcttctcagggctgcagtccggcagagctggccgccggaacagaa
cagcttctccaggtggcctgctcccagtcccgcgagttcatccggcagctgtatgccctg
atggagggaagcgccgctgtaaaagcccatccgctggctggaaccgtgctgctgcacatc
atccgggagtcagagtatgtcttgggcgttttgagcgccctgacattaaccggaaatgct
cccctctggatgcgggaggacatagcgccgcaatcgggagcagcggatgagcataagccc
aaagacagccagaccgggcctggcccgcaggttcccttgattcttcagtcctccgggatt
cgggaacagggcacggtcccgatcgggggccacaccctgcctcccctcccctatgcctat
aatgcgcttgagccctacatcgacgaaaaaaccatgaggattcatcatgataagcatcat
caaagctacgtagacgggctgaacaaggcggagaagaagctggctgaagcccggaaaacc
aaagattttgacctggtgaagcattgggagcgggagcttgccttcaatggagccggccat
tatctgcataccatcttctggaacgtcatgtcaccgcaagggggaggccgtccgacaggc
gcactgctggatgccatagagcacagctttggcagctacgaggccttcaaggaacagttc
acggaggcggccaataaagtggagggcgggggctgggcgattctggtctggagcccgcgc
agccacagactggaaatcctgacagcggagaagcaccagaatctctcccaatgggatgtc
gtccccctgctggctcttgatgtatgggagcacgcatattatcttaagcatcagaataac
cgcgcggattacatcaaggactggtggaaggttgtaaattggccttatgtctccgagcgc
ttcaatgccgcccggaagctggtctggcagcccttctga

DBGET integrated database retrieval system