KEGG   Paenibacillus graminis: PGRAT_04355Help
Entry
PGRAT_04355       CDS       T03325                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
pgm  Paenibacillus graminis
Pathway
pgm00040  Pentose and glucuronate interconversions
pgm00051  Fructose and mannose metabolism
pgm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PGRAT_04355
   00051 Fructose and mannose metabolism
    PGRAT_04355
Enzymes [BR:pgm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     PGRAT_04355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Sacchrp_dh_NADP UDPG_MGDP_dh_N DAO TrkA_N Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AIQ66961
UniProt: A0A089LZN1
LinkDB All DBs
Position
980745..981785
Genome map
AA seq 346 aa AA seqDB search
MKNRAFYMTDLKKLEMNEIGMPVAKEGEIIVKLEYVGICGSDVHYLEHGRIGDFVVEGDF
ILGHECAGAVVGLGPGVKKLKVGDRVALEPGVTCGQCEFCKSGKYNLCPEVKFLATPPYH
GCLMDYIAFPENMAFKLPDSVSSEEGALVEPLAVGLHAAAQGGVKLGDRVVILGAGCIGL
VTLLACKAYGATDIVVVDIIEKRLEAAKQLGASRVINAKQENVRDVISLLTDGQGMDKVI
ETAGSEHTVKQTPYLVKRGGTIVLVGLAAKDIIDFDFMQIMFKEADIQSVFRYRNLYPAA
IGAIADGKIDVKGIVTHEFSFEDTQKAFDFVIDNKEEVVKAVIRMG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacagagctttttacatgacggatctgaagaaattggaaatgaatgaaatcggc
atgcccgtggccaaagagggcgagattattgtcaaactggagtatgtcggcatttgcggt
tctgatgtccactatctggagcatggccggatcggtgatttcgttgtcgaaggcgatttt
attctaggacatgaatgtgccggagcagtagtcgggcttggtcccggggtgaagaagctg
aaggtgggagacagggtcgcactggagcctggagtcacctgcggccagtgtgaattctgc
aagagcggaaagtacaatctctgtccggaggtgaagtttctggctactccgccttaccat
ggctgcctgatggactatatcgcctttccggagaacatggccttcaagctgccggacagc
gtatcttcagaagagggagcgctggtggagccgctggcagtgggactgcatgctgcggcc
caaggcggagtcaagctgggtgaccgtgtcgttattctgggggccggctgcatcgggctt
gtaacgctcctggcctgcaaggcttacggggcaacagatattgtggtcgttgatatcatt
gaaaagcggctggaagcagcgaagcagctgggagcgagccgggtaatcaacgccaagcaa
gagaatgtccgggatgtaatatccctgctaacggacggccagggcatggacaaggtgatt
gaaactgcggggagcgagcataccgttaagcagacgccctatctggtcaaaagaggcgga
acgattgtgcttgtgggcctggcggccaaggatatcatcgatttcgactttatgcagatc
atgttcaaggaggctgacatccaatcggtgttccgttaccgcaatctgtatcctgccgcc
attggagcaatcgcagatggcaaaattgacgtcaaggggatcgtgacgcatgaattcagc
tttgaggatacccagaaggcctttgactttgtgattgataataaggaagaagtggtgaag
gctgtgatccggatggggtga

DBGET integrated database retrieval system