KEGG   Paenibacillus graminis: PGRAT_07765
Entry
PGRAT_07765       CDS       T03325                                 

Definition
(GenBank) sugar phosphorylase
  KO
K21350  sucrose 6(F)-phosphate phosphorylase [EC:2.4.1.329]
Organism
pgm  Paenibacillus graminis
Brite
KEGG Orthology (KO) [BR:pgm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PGRAT_07765
Enzymes [BR:pgm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.329  sucrose 6F-phosphate phosphorylase
     PGRAT_07765
SSDB
Motif
Pfam: Alpha-amylase
Other DBs
NCBI-ProteinID: AIQ67543
UniProt: A0A089M7R4
LinkDB
Position
1717522..1718988
AA seq 488 aa
MVKNQVQLITYPDSLGGDLKSLRHVLDAYFPDVFKGGVHILPPFPSSGDRGFAPLTYLEI
EPAFGDWADIRAIGERHDVLVDLMVNHISRQSPYFQDFLQHGRQSRYADLFLTLDKIWAD
GQPVQADIDKMFLRRSKPYSTFTIEDTQEELQVWTTFGKSDPSEQIDLDIRSEKVKQLFI
QFFTCFKENNIKIVRLDAVGYVIKKLGTSCFFVEPEIYGFLDWIKELADSLDIELLPEVH
SHYSIQYKLAEHGCWIYDFILPYRILDTLLNKDSSELKEYLRTRPAKQFTMLDCHDGVPV
KPDLDDLIDTKDARKIVDTCVERGANLSLIVSEEHKAPDGFDVHQIRCSYYSVLGCDDDA
YLAARAIQFFAPGIPQVYYVGLLAGENDLERVRETGEGREINRRNYTLPEIGQSLEKEVV
QRLLKLIRFRNEYEAFNGDFTVEEAAADEIRLSWTKGEFRCTLYINLDTMRSEIEYTDGE
GVLAQLEV
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggttaaaaatcaagtgcaactgattacttacccggactcgcttggcggagatttgaag
tcactccgtcatgtgctggatgcgtattttccggatgtattcaagggcggggtgcatatt
ctgcctccgttcccttcgtcgggggaccgcggttttgcaccgctgacctatctggagatc
gagcctgcctttggggattgggcggacatccgggcaatcggggagcggcatgatgtgctg
gtggacctgatggtcaatcatatctcccgccagtctccttactttcaggacttcctgcag
cacgggcggcagtcccgctacgccgatctgttccttacgctggataaaatttgggcggac
ggacaaccggtacaggcggacatcgataaaatgttcctgcgccgcagtaagccctactcc
acgttcaccattgaggacacacaggaagagcttcaggtgtggacgaccttcggcaaaagc
gatccgtccgagcagattgatctagatatccgctcggagaaggtcaaacagctgttcata
caattcttcacctgcttcaaggagaacaatatcaagatcgtccggctggacgcggtaggt
tatgtgatcaaaaagctgggcaccagctgctttttcgtcgagccggaaatttatggcttc
ctggactggatcaaggaactggccgattcccttgatatcgaactgctgcccgaggtgcat
tcgcactattcgattcaatacaagctggcggagcacggctgctggatttacgatttcatc
ctgccgtaccggattctcgatacgctgctgaacaaggacagcagtgagcttaaggagtac
ttgcgcacccgtccggccaagcagttcaccatgctcgactgtcatgacggcgtcccggtc
aagcctgacctggacgatctgatcgacacaaaggatgcccgtaagatcgttgacacctgt
gtcgaaagaggagccaacctgagccttatcgtatccgaagagcacaaggcgcccgacggg
ttcgacgtccatcaaatccgctgctcctattactcggtgctgggctgtgatgacgatgcg
tatttggcggcgcgggcgattcagttttttgctccgggcattccgcaggtgtattatgtc
gggctgctggctggtgaaaatgatctggagcgggtgcgggaaaccggcgagggacgcgag
atcaaccgccgcaactatacgctcccggaaatcgggcaatcgctggagaaggaagttgta
cagcgtctgctcaagctgatccggttcagaaatgaatacgaggcgtttaacggcgatttt
acagtggaggaagctgcagcggatgaaatcagactgtcctggacgaagggcgaattccgc
tgcacgctgtacattaaccttgatacgatgcgctctgagattgaatatacggacggggag
ggcgtgctggcgcagcttgaggtgtag

DBGET integrated database retrieval system