KEGG   Paenibacillus graminis: PGRAT_08015
Entry
PGRAT_08015       CDS       T03325                                 

Definition
(GenBank) glucan 1,6-alpha-glucosidase
  KO
K01215  glucan 1,6-alpha-glucosidase [EC:3.2.1.70]
Organism
pgm  Paenibacillus graminis
Brite
KEGG Orthology (KO) [BR:pgm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PGRAT_08015
Enzymes [BR:pgm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.70  glucan 1,6-alpha-glucosidase
     PGRAT_08015
SSDB
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase Glyco_hydro_42C Cyc-maltodext_C
Other DBs
NCBI-ProteinID: AIQ67589
UniProt: A0A089NF04
LinkDB
Position
1778680..1780311
AA seq 543 aa
MNNTKWWQTAVIYQIYPRSFQDSDGDGIGDLRGIINRLDYLEQLGITAIWLSPVYKSPND
DNGYDISNYQEIMSEFGTMEDMDELIERAKLRNIRIIMDLVVNHTSDEHPWFIEARKGKD
NPYRNYYIWRDPVNGGVPNSLRSTFSGSAWEFDEASGQYYLHLFSRRQPDLNWENSKVRQ
EVWDMMNFWLDKGVGGFRMDVIDLVGKIPDQEITGNGPKLHEYLQDMNRETFGKHDVLTV
GETWGATPEVAKLYSDPDRNELSMVFQFEHIGLDQQDGGEKWDLKPLDVSELKQVLAKWQ
TELGNAGWNSLFWNNHDLPRIVSRWGDDKQYRVQSSKMFAILLHLMKGTPYIYQGEEIGM
TNYPIQEISEAQDIETINMYQERIAEGYAKEDIIHSINVKGRDNARTPVQWDHSPNGGFT
TGEPWLHVNPNYKEINMEANLKDPDSVFHCYRKLIELRKNNPIVVWGDFELLTRVPDQVF
MYFRRYEGETWLVTANFSREATTLELPETGQAGEFIIGNYTRDDVDFKQLQLQPYEAFAV
KLA
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgaacaatacaaaatggtggcagacagctgttatttaccagatttatcccaggagtttt
caagacagcgacggggatgggatcggcgatctccgggggattatcaacagactagactat
ctcgagcagctgggcatcaccgcaatatggcttagtcctgtatacaagtctcccaatgac
gataacggatatgatatcagcaattaccaggagattatgagcgaattcggcacgatggag
gacatggatgaattaattgaaagagccaagcttcgcaacattcggattattatggatctg
gtcgtcaatcacacctcggatgagcatccatggttcattgaagcccgcaagggaaaagac
aatccgtatcggaactattatatctggcgcgatccggtaaacggcggagttcccaattcc
ttgcgttcaacattcagcgggtcggcttgggagttcgacgaagcaagcggccagtattat
ctgcacttgttcagccgcagacagccggacctgaactgggagaacagtaaagtccggcaa
gaggtatgggacatgatgaatttctggctggacaaaggcgtcggcggattccgtatggat
gtgattgatctggtcggcaaaataccggatcaggagattacaggaaatggtccgaagctt
catgaatatctgcaggatatgaaccgtgagacgttcggaaagcatgatgttctgacagtg
ggagagacatggggcgcgactccggaagtggccaagctctattccgatccggaccggaac
gagctttcgatggtattccagtttgaacatattggtctggaccaacaggacgggggagaa
aagtgggatttgaagcccctggacgtaagtgaattaaagcaggtattggcaaaatggcaa
accgaactggggaacgcgggctggaacagtctgttctggaacaatcatgatttgccgaga
atcgtatcccgttggggcgatgacaagcaataccgtgtacaaagctccaaaatgttcgcc
attcttctgcatttgatgaagggcacgccttacatctatcaaggcgaagaaatcggaatg
accaattatccgattcaagagatcagcgaagcgcaggatattgagaccatcaatatgtat
caggaacggattgcagaggggtatgccaaggaagatattatccattccattaatgtaaag
ggaagagataatgcccgaaccccggtacaatgggatcattcccctaacggaggatttaca
accggagagccatggctgcatgtaaatccaaattataaggaaataaatatggaagcaaat
ctgaaagatccagattcggtttttcactgctaccgtaagctgattgagctgcggaagaac
aacccaatcgttgtatggggcgattttgaactgctgacccgcgtaccggatcaagtgttc
atgtatttccgccggtatgaaggggagacctggctggtaacggccaattttagcagggaa
gccaccacacttgaattaccggaaacgggtcaggccggggaattcatcattggcaactat
accagagatgacgtggactttaagcaattacaattacagccttacgaagcgtttgccgtc
aaactcgcgtag

DBGET integrated database retrieval system