KEGG   Paenibacillus graminis: PGRAT_08840Help
Entry
PGRAT_08840       CDS       T03325                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
pgm  Paenibacillus graminis
Pathway
pgm00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:pgm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PGRAT_08840
Enzymes [BR:pgm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PGRAT_08840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Cellulase Glyco_hydro_35 Glyco_hydro_42C Glyco_hydro_2_C ABC_transp_aux
Motif
Other DBs
NCBI-ProteinID: AIQ67722
UniProt: A0A089M3D6
LinkDB All DBs
Position
2077129..2079129
Genome map
AA seq 666 aa AA seqDB search
MNQLRYGVAYYDEYMPCERLDEDIAMMKAAGINTVRIAESTWSTHEPQNGVFDFTSVDRV
LDAMHAAGIAVIVGTPTYAVPAWLVKEHPGVLAVTPKGPGKYGARQIMDITSPAYLFHAE
RIIRKLISRVCKHPAVIGYQTDNETKHYETAGDNVQLLFVKYMREKFGTLEEVNRRFGLD
YWSNRINSWEDFPSVVGTINGSLGAEFARFQRGLVTDFLAWQAALVNEYKQPGQFVTQNF
DFEWRGYSYGVQPSVDHFAAAEAFDIAGVDIYHPSQHELTGTEIAFGGDMARSLKRSNYL
VLETQAQAFPHWTPYPGQLRLQAFSHLASGANMVAYWHWHSIHNSFETYWKGLLSHDFKP
NPVYNEAITIGRDFARLSGSLFGLHKKNKVAVMVSNEALSAMEWFKLPDGKNYNDVVRWL
YDGLYRMNIECDFIQPGYAGLSEYSLIIVPALYAVSDEALERLNEYVRQGGHAVYSFKSG
FADETVKVRTTVQPGIISEACGIGYSLFVTPHEVSLKSENAAVCAGDNRVEAWMELITPT
TAEVLLRYDHPHWGQYAAVTRNRYGQGSATYIGCMTSPELAGSILRAAVQEAGLWGADQE
LAFPLIVKTGINPQNQTVRYYFNYSDSPQSLVYPHGPAEELLSGREFAPGEELELAPWGA
AILLEH
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacttcgctacggcgtggcctattacgacgaatatatgccttgcgagaggctc
gatgaagatattgccatgatgaaggcggcgggcatcaacacagtccgcattgctgaatcc
acctggagtacccatgagccgcagaacggcgtgttcgacttcacctcggttgaccgggtg
ctggacgcgatgcatgcggcggggatcgcggtgatcgtcggaacaccgacctatgccgta
cccgcatggctggtgaaggagcacccgggtgtcctggccgtaacgcccaagggaccgggt
aaatacggcgcgcgtcagataatggatattaccagtcccgcctatctgttccatgcggag
cggatcatccgcaagctgatcagccgggtctgcaagcatccggcggtgatcggctaccag
acagacaatgaaaccaagcattacgagacggccggagacaatgtacagctgctgttcgtc
aaatatatgcgggagaaattcggaacactggaagaggtcaaccgccgtttcgggctggac
tactggagcaaccggatcaacagctgggaggacttcccttcggtggtgggcaccattaac
ggcagtctcggggcggagttcgcccgtttccagcgcgggctggtgacggattttctggcc
tggcaggcggcactggtgaacgagtataagcagccggggcagttcgtcacgcagaacttt
gattttgaatggcgggggtattcgtacggagtgcagccatccgtcgaccactttgccgcc
gcagaggccttcgatattgccggcgtggatatttaccatccctcgcagcacgagctgacc
ggaacggagatcgccttcggcggcgatatggcccgctcgctgaagcgcagcaactacctg
gtgctggagacgcaggcacaggcttttccccactggactccatatccggggcagctccgt
ttgcaagccttcagccatctggcctccggcgcgaatatggtagcctactggcactggcac
tccattcataattcattcgagacgtattggaaagggctgctcagccatgatttcaagccg
aacccggtgtataacgaggcaattacgattggcagggattttgcacgtttgagcggatcg
ctgttcggcctgcacaagaagaacaaggttgctgtaatggtcagcaacgaagccctgagc
gcaatggagtggttcaagctgccggatggcaagaactacaacgacgtcgtgcgctggctg
tatgacgggctgtaccggatgaacatcgaatgcgatttcattcagccgggctatgccggg
ctgtccgagtacagtctcattattgtcccggcgctgtatgcggtctccgatgaggctttg
gagcgtctgaatgaatacgtaagacaaggcggccatgccgtgtactcgttcaaaagcggg
ttcgcggacgaaaccgtcaaggtgcgtaccactgtccagccggggatcatcagcgaggcc
tgcgggatcggctacagcctgttcgtgacaccgcatgaggtgtcgctgaagagcgagaat
gcggcagtctgcgccggagacaaccgcgtggaagcgtggatggagctaataacgccgacg
acggcggaggtgctgctccggtacgatcatccgcattggggccaatatgccgcagtgacc
cggaaccgttacggccaggggagcgcgacctatatcggctgcatgacaagcccggagctg
gcaggcagcatcctgagagcagcggtgcaggaggccggattatggggggcggaccaggag
ctggcttttccgctgatcgttaagacaggcatcaatccgcagaaccagacggtccgctat
tactttaattactctgactcgccgcagtcactggtttatccgcacggccctgcggaagag
ctgctgtcgggacgggagtttgccccgggagaggaacttgagctggctccttggggagca
gcaattttgcttgagcattag

DBGET integrated database retrieval system