KEGG   Paenibacillus graminis: PGRAT_10740Help
Entry
PGRAT_10740       CDS       T03325                                 

Definition
(GenBank) hypothetical protein
Organism
pgm  Paenibacillus graminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_1 LRR_9 RsmF_methylt_CI
Motif
Other DBs
NCBI-ProteinID: AIQ68042
UniProt: A0A089M4C3
LinkDB All DBs
Position
complement(2544920..2545807)
Genome map
AA seq 295 aa AA seqDB search
MCDIKYTGGNTVNLDWSHSKLAAMPDLDDQPLHELTELNLYDNQFGSIPEEVLQMHNLEI
LNLSVNMLHTISPGITALHKLKMIDFGHNQIESVPAEIGKLAQLEDYLYLHNNRLYTIPP
EIGQLSKLKYLNLSDNSLTELPDELGGLAGMVELRIMNNQLTGLPEAFGGLGNLRELHLK
NNRLSGLPEIFGGLPLLRVLDAEDNELLQVPESLSECTRLRRLNLRNNRLSVLPEGIGSL
TNLLELDLRSNHLLEIPESLLEIKGLERLDLRWNHKLNLPGWLHQLEDNGCIVYL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atatgcgacattaaatacactggaggaaacaccgtgaaccttgattggtcccacagtaag
ctggcagcaatgcctgatctggatgatcagcccttgcatgaattgacagaactgaatctc
tacgacaaccagttcggcagcatccctgaagaggtgctccagatgcataatctggagatt
ctgaatctctcggtcaatatgctgcatactatttcacccggaatcacagcactccacaaa
ctcaaaatgatagacttcggccataatcaaatcgaatcggtacccgcagagatcggaaag
ctggcacagctggaggactacctctatctccacaacaatcgtctctataccatccctccc
gaaataggacagctatcgaagctgaaatatttgaatctcagcgataattcactgacggaa
ttgccggacgagcttggcggtcttgccggaatggtcgaactgcggatcatgaacaatcaa
ttaaccggcttacccgaagctttcggcggtctcgggaatcttagagagcttcatttgaaa
aacaaccgcctctccggactcccggagatatttggcggactgccgctgctccgcgtgctg
gatgctgaagataatgaactgcttcaggtgcctgaatctttaagcgagtgtaccagactg
cggaggctgaatctgcggaataaccggctgtccgtgcttcccgaggggatcggaagtttg
acaaatttattggaactggatctaagaagcaaccatctcctggaaatccccgaatccctg
ctggaaatcaaagggctggagcgtttagacctgcgttggaatcataagctgaaccttccg
gggtggctgcaccagttggaggacaacggctgtatcgtatatttgtaa

DBGET integrated database retrieval system