KEGG   Paenibacillus graminis: PGRAT_20095Help
Entry
PGRAT_20095       CDS       T03325                                 

Definition
(GenBank) histidine kinase
Organism
pgm  Paenibacillus graminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c Response_reg His_kinase 7TMR-DISM_7TM HisKA HATPase_c_3 HATPase_c_2 HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: AIQ69673
UniProt: A0A089MDV9
LinkDB All DBs
Position
4466825..4469962
Genome map
AA seq 1045 aa AA seqDB search
MMKKPVAFFLKNIAIVLMYLVILLGLRWLWFTAYAAPEHPQAVQGVLDLRSFDIENSRSI
TLDGEWEFYPEQFLTHEDFPQSGKDMEKHGLVKVPGDWSSGFTEEGHSSFGYGTYRLRIL
TGQPLKDPYGFWIQRIQAASEIEINGQKENPFGRLAEYKEGYTPRAVSYTATYTTGAKQE
IELLVRAANFDHPRKGGIVRSIRFGSQAAVDTERWYSIGFQLVAFIIMLLHALYAGILYC
FNRQKVFLLFFLLLVAVGMSIISDNDTLLRLWLPINYTWLLKIKLLSYMWLSFFMLQLSQ
SFSGRPKAGILFRSYAAVLGLYSAFIIIMPAEFILYTTPLFSILYLLPVAGVVWKIVQMV
LGKQEDAVFLLCAAVAILSSVLWGALESTGSTSSFFYPVDIIIAIIGFSAYWFKRYFRNS
EENLKLNRQLQDNDRLKDQFLANTSHELRTPLHGIISIAQTVAAKEHAVMDQKSVQDMDL
LLTISRRMSHLLNDLLDVTRLQDKRIVLQREPLSIQSLVSGVIDMFEFMTEGRALTLKNN
IAGSLPPVFADEKRLVQILFNLLHNAVKYTIEGSIAVTAETQGKQMIIHVADTGAGMDEE
TLSRIFKRYEQGQQGINDGGGIGLGLSICKQLVELHHGTLTVRSQPGQGSEFTFTLPLAE
VTGQPSSPFSRQELPKNAESTRPSIPAHSPLADLSTIWSAAHSVESEGAGGRIHILAVDD
DSVNLKVLASILSTENYHIRTALSAHEALAMLGTEQWDLLIADVMMPHMSGYELTRIVRE
RFSLSELPILLLTARTQPEDIYTGFLSGANDYLVKPVDGLELKYRVRSLTGLKQSIDEML
RMEAAYLQAQIQPHFLFNTLNSIMALSEIDTAKMRDLSEAFSSYLRISFDYMNSHQRVAL
SHELELVRAYVYIEQARFEERLAVEWDIEDGINPSLPPLTLQPLVENAVRHGLLSRSRGG
LLTIRIRSSGGFTFFEVRDNGKGMTQEQVSRLLDNSRKFSRGIGLLNTNRRLTQLYGRGL
SIQSEPGQGTSVSFMIPEPGNPEGK
NT seq 3138 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagaaacccgttgctttttttctgaaaaacatagctatagtcttgatgtatctg
gtcatccttttaggactgcgctggctttggttcacagcttatgccgcacccgagcaccca
caggcggttcagggcgtgctggatttgcgcagctttgatattgaaaactcccggtcgatt
acattggatggcgaatgggagttttaccctgaacaatttttaacacatgaggatttccct
cagtccggtaaagacatggagaagcatggtcttgtgaaagttccgggtgactggagcagc
ggatttacggaagaaggccattcctccttcggatacgggacatacagactgcggattctg
accggccagccgctaaaagacccctacggtttctggattcagcgcattcaggcggcctcg
gagattgagattaacggacagaaggagaatccctttggccgtttggcggaatacaaggaa
ggttatacccctagggcagtgtcctacaccgcgacttatacaaccggagcaaagcaggag
attgagctgctcgtccgcgccgccaatttcgaccacccccggaaagggggcatcgtccgt
tccatccgcttcggatcacaagctgcggtagatacggagcgctggtattccattggcttt
cagctggtcgcattcattattatgctgctgcacgccttgtatgcagggattttatattgc
tttaaccggcaaaaagtctttcttctttttttcctgctccttgtcgcagtcggcatgtcc
atcatctcggataatgatacactgctgaggctctggctgccgattaattatacctggctg
ctgaagattaagcttttgtcttatatgtggctgtctttttttatgctgcagctgtcacaa
agcttctcgggaaggccgaaggccggtattcttttcagaagctatgctgcggtactgggc
ctgtattcggcttttatcataattatgcctgcagaatttattctgtacactactcccttg
ttcagtattttgtatctgctccctgtagccggtgttgtctggaagattgtgcaaatggtg
ctgggaaaacaagaggatgccgtatttctgctgtgtgccgcggtcgccatcctgtccagt
gtgctttggggtgctttggaatccacgggaagtaccagcagcttcttttatcctgttgat
attattattgcaattatcgggttctccgcttattggttcaagcgttacttccgtaattcg
gaggagaacctcaagctgaaccggcaactgcaggataatgaccgtctaaaggaccagttc
ctggctaatacttcgcatgagcttaggacgccgcttcatggcattatcagtattgcccag
actgtcgcagccaaggaacatgccgtgatggaccagaaaagtgtacaggacatggatctg
ctcctgaccatcagccgccggatgtcacatctgctgaatgacctgctggacgtaacccgg
cttcaggataaacggattgtgctgcagcgggagccgctgtctatccagtcgctggtctcc
ggcgtgattgatatgttcgaatttatgacagagggccgggcgctcactttgaaaaacaac
attgccggctctcttcctccggtgttcgcagatgagaagcgactggtccagattctattc
aatctgctgcacaatgcagtcaaatatacgattgaaggcagtatagctgtaactgcagaa
actcagggcaagcaaatgatcattcatgttgccgatacaggggccggtatggatgaggag
acactcagccggatattcaaacgctatgagcaagggcagcaggggattaatgacgggggc
ggaatcggcctcgggctgagcatttgcaaacaactcgttgagcttcatcatggaaccctg
acggtccgttcacaaccagggcaaggctcggagttcaccttcactcttcccctggcagag
gtaaccggccaaccttcttccccattttccaggcaagagctgccgaaaaatgcggaatca
accagaccttccattccggcacacagccctctcgcagacttgtccacaatctggagcgct
gcgcattccgtagaatcagaaggggctggcggccggatccatattctggccgtggatgat
gattccgttaatctcaaggtactggccagtatcctctctacagagaattaccatatcagg
accgcgctaagcgctcatgaagccttggccatgctgggaacagagcagtgggatctgctg
atcgccgatgtgatgatgccgcacatgtccggctatgagctgacgcgaattgtgcgtgag
cgtttttcattatcggagctgcccattctgcttctgacggcccgcacacagcctgaagat
atttataccggatttctgtccggtgcgaacgattacctggtcaaaccggttgacggattg
gagctgaaatacagagtccgttcgctaacgggactgaagcaatccatagatgagatgctg
cgtatggaagccgcctatctccaggcgcagattcagccgcactttttgttcaacacttta
aattcaattatggccttaagcgaaatcgataccgccaaaatgcgcgatctcagtgaggcg
ttctcctcctatttgcggatcagcttcgattatatgaattcgcaccagcgggttgcgctc
tcccatgagctggaactggtccgggcttatgtgtatatcgagcaagcccggttcgaagaa
aggctggccgtcgaatgggatatcgaggacgggattaatccttcactcccgcccctaacg
ctgcagcctctggtggagaacgcggtcagacacggtctgcttagccgctcgcgcggaggc
ctgctgaccatccgcattcgcagcagcggaggcttcactttcttcgaggtcagggacaac
gggaaaggcatgacgcaggaacaggtcagccgcctcctggacaattcccgcaaattcagc
cgcgggatcggcctgctcaatacaaaccgccgtctgacccaattgtatggccgcggactg
tctattcagagtgagccgggacaaggaacctctgtctcttttatgataccggaaccgggt
aacccggaaggaaaatga

DBGET integrated database retrieval system