KEGG   Paenibacillus graminis: PGRAT_23665
Entry
PGRAT_23665       CDS       T03325                                 

Definition
(GenBank) sugar phosphorylase
  KO
K21350  sucrose 6(F)-phosphate phosphorylase [EC:2.4.1.329]
Organism
pgm  Paenibacillus graminis
Brite
KEGG Orthology (KO) [BR:pgm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PGRAT_23665
Enzymes [BR:pgm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.329  sucrose 6F-phosphate phosphorylase
     PGRAT_23665
SSDB
Motif
Pfam: Alpha-amylase
Other DBs
NCBI-ProteinID: AIQ70305
UniProt: A0A089MD61
LinkDB
Position
5247530..5248999
AA seq 489 aa
MTIKNQVQLITYPDSLGGDLKTLKEVLYSHFTGVFKGGVHILPPFPSSGDRGFAPLTYLE
IDPSFGTWDDIREIGEEFDILVDLMVNHISQKSEYFQDFLKSGRNSKYSDLFLTLDKLWK
DGTPVQEDINKMFLRRPLPYSAFQIQETGTEERVWTTFGKTDPSEQIDLDVSSELTKQIL
TSFFQNFKKHKVKIVRLDAVGYVIKKLGTSCFFVEPEIYDFLDWVKELARSLEIELLPEV
HSHYSIQYKLAEHGCWIYDFILPYRILDTMINQSSDALCDYLKNRPAKQFTMLDCHDGIP
VKPDLDDLIDTTEAKKLVDTCLDRGSNLSLILSDEHKGTDGFDVHQIRGTYYSVLNSDDD
SYLAARAIQFFAPGIPQVYYVGLLAGENDYERVQETGDGREINRHNYTLEEIEQSLQKQV
VQRLLKLIQFRNDYEAFNGVFEVMKSSNEEVRLRWDNNGKYCELFIDLMTKRTTIQYIDE
NNDLIEYIV
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgactataaaaaaccaggtacaattgattacatacccggattcacttggcggagattta
aaaacactaaaggaagtgctgtactcacattttaccggggtattcaaaggcggagtgcat
attctccctccattcccttcttctggcgacagaggctttgccccgcttacctatcttgaa
attgacccctcatttggaacatgggacgatattcgtgaaattggggaagaatttgatatc
ctggttgacttgatggtcaatcatatttcacagaagtcggaatatttccaagacttccta
aagtctggccgtaactcaaaatattcggatctgttcctcaccctggataaactatggaaa
gatggaacccctgtacaagaagatatcaacaaaatgtttttgcgcaggcctctgccctac
tctgcctttcagattcaagaaaccggtacagaggaaagggtatggactacgtttggaaag
acggatccatccgaacaaattgatttggatgtaagttcagagctgacaaaacagatccta
acgtcgttcttccaaaatttcaaaaaacacaaggtcaagatcgtacgcttggatgcagtc
ggttacgtaattaagaagctgggaaccagttgcttttttgtggagccagaaatttatgac
ttccttgattgggtcaaagaacttgccagatcactagagattgaattgctgccggaggtg
cactcccattactccattcagtataaattggcagagcacggttgctggatttatgacttt
attttgccctatcggattctggataccatgattaatcagtctagcgatgctctatgcgac
tacttgaagaaccgccccgccaagcagttcacgatgcttgactgccatgacggtatacca
gtaaaacctgatttggatgatctgattgatactacagaggccaaaaaactagtagacacc
tgcctagatagaggatctaatctcagtttaattctttcggatgagcataagggaacagat
ggcttcgatgtgcatcagatccgcggtacctattactctgttcttaactccgatgatgat
tcttatctggctgccagagccattcaattttttgcccccggaattccacaggtgtattat
gtagggctgcttgccggcgagaatgactacgaacgggttcaggaaaccggtgacggccgt
gaaataaatcgtcacaactacacacttgaagaaatcgagcaatcgcttcaaaaacaggtc
gtacaacggcttttgaagctcattcaattcagaaacgattatgaggcatttaatggcgtg
tttgaagttatgaaatcttcaaatgaagaggttagattgcgctgggacaataatggaaaa
tactgcgaactatttatcgaccttatgaccaagcgaaccactatccaatacattgatgag
aataacgacttgattgaatatattgtctga

DBGET integrated database retrieval system