KEGG   Paenibacillus graminis: PGRAT_28890Help
Entry
PGRAT_28890       CDS       T03325                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pgm  Paenibacillus graminis
Pathway
pgm00620  Pyruvate metabolism
pgm00680  Methane metabolism
pgm01100  Metabolic pathways
pgm01120  Microbial metabolism in diverse environments
pgm01200  Carbon metabolism
Module
pgm_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pgm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PGRAT_28890
  Energy metabolism
   00680 Methane metabolism
    PGRAT_28890
Enzymes [BR:pgm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PGRAT_28890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 OTCace ING
Motif
Other DBs
NCBI-ProteinID: AIQ71160
UniProt: A0A089MFK4
LinkDB All DBs
Position
complement(6383776..6386568)
Genome map
AA seq 930 aa AA seqDB search
MTELTTAVSKSNSNNLLRRDVRFLGNILGEVLVHQGGNELLEIVEKIRETSKSLRSLFLP
ELHNEFKELINSLDPENRHQVIRAFAIYFQLVNIAEQNHRIRRKRDYERSAGETVQPGSI
ESAIQELRERDFSHEDVHEIMNGLSLELVMTAHPTEAMRRAILDIHKRISDDVMGLDNPT
LTFREREQLREKLLNEVITLWQTDELRDRKPTVLDEVRNGMYYFHETIFQVLPDVYQELE
RCLSKYYPGQNWHVPTYLRFGSWIGGDRDGNPSVTAAVTLQTLRLQRKLAIREYQRIMRE
LMQYLSFSTSIVKVTPELLESIELDRGIIQLDKTKSWHNDNEPYRIKLTYMIAKTQNVMD
DEKKGSLERYSSPEQFIDDLNVIDRSLRHHYADYVADTYIKKLIRQVELFGFHTATLDVR
QHSQEHENAMTEILAKMNVTQDYAKLQENEKIELLEKLLNDPRPLTSPYQTYSESTEECL
AVYRTIYTAQEEYGKQCITSYLISMAEAASDILEVMVFSKEVGLFRKDNDGTVVCTLQAV
PLFETIDDLHDAPQIMRTLLNLPIYRDAVRAMNDLQEIMLGYSDSNKDGGVVTANYELRV
ALKEITATADEFGIKLKFFHGRGGALGRGGMPLNRSILAQPASTIGGGIKITEQGEVISS
RYSMQGIAYRSLEQATSALITAAINARSPQADLYDPKWEEIVARISEVSLNKYQDLIFRD
PDFLNYFKESTPLPEVGELNIGSRPSKRKNSDRFEDLRAIPWVFAWTQSRYLLPAWYAAG
TGLQSFYDGKEENLKIMQHMYEEFSFFTTLIDTLQMAIAKADLIIAKEYAGMGKNEEARH
RIFGQIEAEFKLTSELILKITGQQDILDNVPVIQESIRLRNPYVDPLSYLQVQLLSELRA
LREAEGDDAELLREVLLTINGIAAGLRNTG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacttacgactgccgtcagcaaaagcaactctaacaatctgctgcggcgagac
gtacggttcctggggaatattttgggcgaagtcttggttcaccaaggcggcaacgaactg
ctggagatcgtagagaagatccgcgaaaccagcaaatcgctgcgctcattgtttttgcct
gaactgcacaatgaattcaaggagctaatcaattcacttgatcctgagaatcgacaccag
gtgatacgggcgttcgctatttattttcaattggtgaacattgccgagcagaatcaccgg
attcgccgaaaacgcgactacgaacgttcagccggggagactgtacagcctggttctatc
gaaagcgcgattcaggagctccgcgaacgggatttctcacacgaggatgttcatgagatc
atgaacggcctgtctttggagctggtcatgacggctcaccctacggaagccatgcgacgg
gcgatccttgatattcataagcgtatctctgatgatgtgatgggtctggataaccctacc
ctgacattccgggaacgcgaacagctgcgtgagaagctgctgaatgaagtcattacctta
tggcagacggatgagctgcgcgaccgcaagcctacggtactcgatgaagtccgcaatgga
atgtactatttccatgagacgattttccaggtgctgccggatgtgtatcaagaacttgaa
cgatgtctaagcaaatattatccgggccagaattggcatgttcccacctatctgcggttt
ggctcgtggatcggcggggaccgtgacggcaacccttcggtaaccgcagctgtgaccctg
cagaccctgcgtttgcagcgcaagctggcgattcgggaatatcagcgcattatgcgcgaa
ctgatgcagtatctgagttttagtacaagtatcgttaaggtgacgccggagctgctggaa
tccattgaactggaccggggtattattcagctggataagacgaaatcctggcataatgat
aatgagccataccggattaagcttacctatatgatcgcgaagacacagaatgttatggat
gatgagaaaaaaggctcattggagcgctactcctcaccggagcaatttatagatgattta
aatgtgattgaccgcagcttgcgtcatcactatgccgattatgtagcggatacctacatt
aagaaattgattcgccaggtagagttgtttggattccataccgcaactcttgatgtccgc
cagcacagtcaggagcatgaaaatgcgatgactgagattttggccaaaatgaatgttacg
caggattatgccaagctgcaggaaaacgagaagattgaactcctggaaaaactgctgaat
gatccgcggccgctaacttcaccatatcagacttacagcgagagcacggaagaatgtctt
gctgtgtaccgtactatttatacggctcaagaggagtacggcaaacaatgcatcaccagc
tacctgatcagcatggctgaagctgcaagcgatattctggaggttatggtgttctccaag
gaagtcggcttattccgcaaagacaacgatggtactgttgtttgtacacttcaggctgtg
ccgttgttcgaaaccattgacgatctgcatgatgcaccgcaaattatgcggacactgctc
aacctgccaatctaccgtgatgcggttagggcgatgaatgatctgcaggagatcatgctg
ggatattcggacagcaacaaggatggcggtgtggttaccgccaactatgagctgcgtgtg
gcactcaaggaaattacggctacggcggatgaattcggcatcaaactgaaatttttccat
ggccgcgggggagcccttggccgcgggggcatgccgctgaaccgcagtattctggctcaa
ccggcctcgacgattggcggcggcattaagattacagagcagggcgaagtcatctcctcc
cggtactcgatgcagggaatcgcctaccgcagcttggaacaggcaacttccgcgctgatt
acggcagcgattaatgccagatcaccgcaggctgatctgtacgatcctaaatgggaagag
attgtagcccggatttctgaagtatcactgaacaaatatcaggacctgatcttccgtgat
ccggatttcctgaactacttcaaggagtcgacgccgcttcctgaggtgggtgagcttaac
attggttcgcgtccttccaaacgaaagaacagcgaccgctttgaagatctgcgtgccatc
ccttgggtttttgcctggacacagagccgttacctgcttccagcatggtacgctgccgga
acggggctgcagagcttttacgacggcaaggaagagaacctgaagatcatgcagcatatg
tatgaagaattttcgttcttcactacattaattgatactctgcaaatggcgattgccaag
gcggatctgattatcgccaaggaatacgccggcatgggcaaaaatgaggaagcccgtcac
cgtatcttcggacagatcgaagcggaattcaaactgacctccgagctgattctcaaaatc
accgggcagcaggatattctggataacgttcctgtcatccaggaatccattcgtttgcgg
aatccttacgttgatccgctcagctatctgcaggtgcagctcttgtcggagcttagagcc
ctgcgtgaagccgagggagatgacgccgagcttctgcgcgaggtgctgcttacgatcaat
ggcattgccgccggactgcggaataccggctga

DBGET integrated database retrieval system