KEGG   Porphyromonas gingivalis ATCC 33277: PGN_0661Help
Entry
PGN_0661          CDS       T00714                                 

Definition
(GenBank) alkyl hydroperoxide reductase F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Brite
KEGG Orthology (KO) [BR:pgn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PGN_0661
Enzymes [BR:pgn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PGN_0661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like GIDA FAD_binding_2 Thioredoxin_3 FAD_oxidored NAD_binding_8 Thi4 NAD_binding_7 DAO FMO-like Lycopene_cycl AlaDh_PNT_C DUF2190 K_oxygenase FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: BAG33180
UniProt: B2RII5
LinkDB All DBs
Position
718974..720521
Genome map
AA seq 515 aa AA seqDB search
MLDKDTLTQVGSYFAQLKKSYTLRLNAHTSHPSYNEAKEMLDGLASVSDHVRAEYNAADD
FRIDLLVDGADSGIGFRGIPGGHEFSSLLLAILNNDGIGRNIPDGGVQDRIRRINGPIEL
KTYVSLSCTNCPDVVQTLNMIAILNPTINHTMVDGSFFPDEVESLGIASVPTVMAGDEVI
HVGRGDMAALLNKIEAKYGSVPAESADKTLRPFDLLVVGGGPAGSAAAIYSARKGLKVAI
IAERVGGQVNETVGIENLISVPYTTGSELASNLNSHIKANTISLFEARTVSSITQQEGIS
RVEVTSGEVFTAPSLIMATGASWRKLGVPGEKEYTGNGVAYCAHCDGPFFKGKRVAVVGG
GNSGLEAAIDLAGICEHVTVVEFLDVLRADEVLQKKARETANIDILLSTATKEIMGNGQK
VEGILLTDRNTGEEKQIALSGVFVQIGLAANTSLVKDLVETNSRGEVLIDTSCRTNTPGI
YAAGDCTTVPYKQIVIAMGEGAKAALSAFEDRIRG
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgcttgataaagatactcttacccaagtgggctcttactttgcccaactgaaaaagtcc
tatacattacgactcaatgctcatacgtctcatccctcctacaacgaggcgaaggaaatg
ctcgatgggcttgcatccgtttcggatcatgttcgtgcggaatacaatgcggcagatgat
tttcgtatcgatctgctcgtagacggagcggatagcgggatcggcttccgtggtattccg
ggtggccatgaatttagctcactgcttcttgctattctcaacaatgacggtatcggaagg
aatatccccgatggaggagtacaggatagaatccgccgtatcaatgggccgatagagctg
aaaacctatgtatccctctcttgtacgaattgtcccgatgtggtgcagaccctcaatatg
attgccattctcaatccgactatcaaccacaccatggtcgatggttctttcttcccggac
gaagtggagtcgttgggtatcgcttccgttccgacggttatggccggagatgaagtgatc
catgtggggcgtggcgatatggctgccttgctgaacaagatagaagccaaatatggctct
gtccctgccgagtcggcagataagacgctgcggcctttcgacctccttgtcgtgggtggt
ggcccggccggatcggctgcagccatctattctgctcgcaaggggctgaaggtagccatc
atagccgaacgggtaggcggccaagtaaacgaaacggtcgggatcgagaacctgatttcc
gtgccttacaccacaggatcggaacttgcatccaacctcaattctcacatcaaggccaat
acgatctccctcttcgaggcccgaaccgtgtcgtccatcacacaacaagaaggtatatcc
cgtgtggaagtgacttccggagaagtcttcacggctccttctcttatcatggctacgggt
gcttcatggcgcaagctcggtgtacccggcgagaaagaatatacgggtaatggtgtagcc
tactgcgctcactgcgatgggcctttcttcaaaggcaagcgtgtggccgtggtcggtgga
ggcaattccggtctggaagctgccatcgatttggccggtatatgcgagcatgtcactgta
gtagagtttctggatgtactcagggctgatgaggtgcttcaaaagaaagcacgtgaaacg
gccaatatcgacatcctcctcagtactgctaccaaagaaatcatgggcaacggacagaaa
gtggagggaatactgcttaccgatcgcaacacgggagaggaaaagcaaatcgcactcagt
ggcgtattcgtacagatcggtcttgccgccaatacatcccttgtgaaagatttggtggaa
acaaacagccgaggcgaagtactcatcgatacttcatgccgtaccaatacgcccggcata
tatgctgcaggtgactgtaccactgtgccctacaaacagatagtcattgccatgggcgaa
ggagccaaagctgctctttctgctttcgaggatcgcatccgtggctga

DBGET integrated database retrieval system