KEGG   Porphyromonas gingivalis ATCC 33277: PGN_1004Help
Entry
PGN_1004          CDS       T00714                                 

Definition
(GenBank) putative ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Brite
KEGG Orthology (KO) [BR:pgn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pgn02000]
    PGN_1004
Transporters [BR:pgn02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    PGN_1004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 DUF4162 AAA_23 AAA_15 Rad17 AAA_29 AAA_30 AAA_16
Motif
Other DBs
NCBI-ProteinID: BAG33523
UniProt: B2RJH8
LinkDB All DBs
Position
1114372..1115331
Genome map
AA seq 319 aa AA seqDB search
MPFLEANHIRKRYAAHTALDDVSISVRKGRVFGLLGPNGAGKTSLIRIINRITAPDEGKV
IFDGRPMQAEDVRRIGYLPEERGLYPKMKVGEQAIYLAQLKGVNKHEARKRLTDWFEKFD
IMPWWNKKVEELSKGMQQKVQFVCTVIHEPELLIFDEPFSGFDPVNADLLKREILELAGK
ERTVIFSTHNMQSVEEVCDDFALINKSRVVLHGAVREVRRENSLGIIRMVVEGELPADYL
GRIRILEKTELPGSMTKLRVRKETTAHNRDLVRDLPESVRLVSFYEEIPSMHDIFIKTVG
HGVEEENPIQAQQENTDTH
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgccatttttagaagccaatcatattcgcaagcggtatgcagcccatactgcgctggac
gatgtgagcataagcgtccggaaggggcgcgtcttcggtctgcttggccctaacggtgcc
ggcaagaccagtctgatacgtatcatcaaccgcatcaccgctcccgacgagggcaaagtg
atcttcgacggccgtcccatgcaggcggaggacgttcgccgcatcggctatctgcccgaa
gagcgagggctgtaccccaagatgaaagtgggcgagcaggccatctatctggcgcaactc
aaaggagtaaacaaacacgaagcgcgcaagcggctcaccgactggttcgagaagttcgac
atcatgccctggtggaacaaaaaagtggaggagctgtccaaagggatgcagcagaaggtg
cagttcgtgtgcaccgtcattcacgaaccggaattgctcatattcgacgaacccttcagc
ggattcgatccggtcaatgccgacctgctgaagcgtgaaatactggagctggccggcaag
gagcgtaccgtcatcttctcgacgcacaacatgcagtcggtggaagaagtatgcgacgac
ttcgcgctgatcaacaaatcgcgcgtagtgctccacggagccgtgcgcgaagtgcgcagg
gagaacagcctcggcattatccgcatggtagtcgaaggcgagctgccggcagactacctc
ggccggatccggatactggagaagacggagctgccgggttccatgacgaagctgagagtg
cgcaaagaaaccacggcgcacaaccgcgatctcgtgcgcgacctgcccgagtcggtacgg
ctcgtgtccttctacgaagagatcccgagcatgcacgacatattcatcaagaccgtaggc
cacggcgtagaggaagagaatccgatccaagcacaacaagaaaacaccgatacacactga

DBGET integrated database retrieval system