KEGG   Porphyromonas gingivalis ATCC 33277: PGN_1194Help
Entry
PGN_1194          CDS       T00714                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
pgn00473  D-Alanine metabolism
pgn01100  Metabolic pathways
pgn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pgn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PGN_1194
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    PGN_1194
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pgn01011]
    PGN_1194
Enzymes [BR:pgn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     PGN_1194
Peptidoglycan biosynthesis and degradation proteins [BR:pgn01011]
 Precursor biosynthesis
  Racemase
   PGN_1194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase
Motif
Other DBs
NCBI-ProteinID: BAG33713
UniProt: B2RK18
LinkDB All DBs
Position
1326445..1328916
Genome map
AA seq 823 aa AA seqDB search
MFLFSELCRRLSPDAVRIVSDHRIVHLLTDSRTLSEPATTLFFALRTTSGDGHLYIRDLY
DKGVRSFVISDPSKDLMEKMPQANWMRVAHPLDALQRIAALRRSMFDIPVIGITGSNGKT
IVKEFLYQLLRKDYRIVRSPRSYNSQIGVPLSVWQMAEEHTLGIFEAGISQMGEMERLES
IICPSYGIITNIGGAHQENFPDIKTKLEEKLRLFPHCHTIVYNGDCEEIAAAISFCGLAR
AGVSWSRTKPEAHLYVCRLESKDNRTEIDFRCLGKDYSLVLPFTDAASIEDIIHCITLIS
VLCPEVLSARKRFASLEPVEMRMEVKAGDHGNTIINDVYSNDVYSLTLALDFQRRRTAET
CLKKVLILSDILQSGMPPEELYRHVAGQLQVYALDFFVGIGEEIASHRTCFAGMSAVFFK
DVAAFLTSGEIERFSNSCILLKGARKYRFEQITERLVQQVHETALRINLSAIIHNLNFYR
NLVPSGTKTICMVKAQGYGVGSYELVKTLQEHRVDYIAVAVADEGKELRERGISMPIVVM
NPQRNAFQTLIDYGLEPEIYSFALLASFSETVVRNGLVGYPVHIKIDTGMHRLGFLPSDM
TRLGEILAKDAGLSIRSVFTHLAGADDPDLDDFTRSQLLSFDAAFASLSSLLGYIPLRHV
LNTAGVERFADYHADMIRLGIGLYGVTASGVQGLRPVATLMTTILQIKDISSSDTVGYGR
KGRVQQPSRIAIIPIGYADGLDRRLSCGVGEVLVRGHRCPIVGNVCMDICMIDVTGMPAE
EGDPVVVFGEELPIEEVAHKMNTIPYEVLTGISPRVRRVYFQE
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttttctccgaactatgcagacgtttatcccctgatgcggtaagaatcgttagc
gatcaccggatcgtccatttgcttaccgatagccgtacgctgtccgaacctgctactact
ctcttcttcgccttacgcaccacatcgggcgatggccatttgtatattcgagatctatat
gataaaggagtaaggagttttgtcatttcggatccctccaaagatttgatggagaaaatg
ccgcaagcgaattggatgcgcgtggctcatccgttggacgctctacaacggatagccgca
ctaaggcgttctatgttcgatattcctgtgataggaattaccggaagcaatggcaagaca
atcgtcaaagagttcctttatcagttattgcgcaaggactatcgcattgtccgctcgccc
cgaagctataactcgcagatcggagtacctctttccgtatggcaaatggcggaggaacac
actctcggtatatttgaagccggcatatcgcaaatgggggaaatggaacgtttggagagc
ataatatgcccctcgtatggtatcattacgaatataggaggtgctcatcaggagaatttc
ccggatataaaaacgaaactggaggaaaagcttcgcttgttcccccattgtcatactatt
gtctataacggcgactgcgaagagatagctgctgctatctctttctgcggtttggcaaga
gccggagtttcatggagccggacgaagcccgaagctcatttgtatgtgtgcagattggaa
tcgaaagataatcgcaccgagattgattttcggtgtctcggcaaagattattctcttgtg
ctaccattcacagatgctgcttccatagaagatatcatccattgcatcacgctgatttct
gtactgtgtccggaggtcttatctgctcgaaagcggtttgcgagtttagagcctgtagaa
atgcgaatggaggttaaggccggagatcatggcaatacgatcatcaatgacgtttacagt
aatgatgtctattcgcttacgctggccttggatttccaacgaagacgtactgccgaaaca
tgcctaaagaaagtgttgatactgtccgacatcttgcaaagcggaatgcctcccgaagaa
ttgtacagacatgtggcaggacaattacaagtctatgctcttgactttttcgtcggcatc
ggagaggaaatagcctcgcatcgcacttgttttgccggcatgtctgccgtttttttcaaa
gatgttgctgcattcttgacatccggtgagatagagcgcttctccaacagctgtattctg
ctcaaaggtgcacgcaagtatcgcttcgaacagattacggagcgacttgtacaacaggtg
cacgaaactgcgctaaggatcaatctgtcagctatcatccacaatcttaatttctatcgg
aatttagttccatcaggcaccaaaaccatctgcatggtcaaggctcagggctatggcgta
ggctcttacgaacttgtcaaaaccctgcaggagcatcgtgtggattatatagctgtagcc
gtagcggacgaaggcaaagaactaagagagcgaggtatcagtatgcctatcgtggtcatg
aacccccaaaggaatgcctttcagacactcatagactacggattagagcctgagatttat
agctttgcccttctcgcttctttttcggaaacggtcgtacgcaacggcctcgtgggctat
cctgttcatatcaaaatcgacacgggaatgcaccggcttggttttttaccgtctgatatg
acacgactcggtgagattcttgccaaagatgccggactgagcattcgctctgtatttact
catcttgcaggtgccgacgatcctgatttggatgattttacgcgatctcaactgctgtct
ttcgatgctgctttcgcctctctctcctctttattaggctatatacctctccgtcatgta
ttgaatacggcaggggtagagcgttttgccgactaccatgccgacatgattcgtcttggc
atcggcttgtatggagtaacggcatccggcgtacaaggattgagaccggtagccaccctg
atgactacaattttgcagatcaaggatatttcttcgagcgatacggtcggatatggacgt
aaaggacgggtacaacaaccatctcgaatagctattatacctatcggttatgccgatggc
ttggatagacgtttgagttgtggagtaggagaagtacttgtgcgtggacatcgctgtcct
atagtagggaatgtctgtatggatatctgtatgatagatgttaccggtatgccggcagaa
gagggagaccctgtcgttgtattcggagaagaactcccgatcgaagaagttgcccataag
atgaatactatcccctatgaggtgctcacgggtatctcgcctcgtgttcgcagagtttat
ttccaagagtag

DBGET integrated database retrieval system