KEGG   Pseudobacter ginsenosidimutans: FSB84_26195Help
Entry
FSB84_26195       CDS       T06126                                 

Definition
(GenBank) YihY/virulence factor BrkB family protein
  KO
K07058  membrane protein
Organism
pgo  Pseudobacter ginsenosidimutans
Brite
KEGG Orthology (KO) [BR:pgo00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    FSB84_26195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: QEC45003
LinkDB All DBs
Position
6694973..6695932
Genome map
AA seq 319 aa AA seqDB search
MTKLERILLNLPPVKFLTEKSKHIILPGFDKVPLYDVILFFLSQVKKVGLTERAAAVAYN
FIMAIPPTCLFIFTLIPQLPFIPKETIELQLHHLINDIIPAKEYNQGIIDFVDGFLNQPR
VGLISFGFFLLIFFASNGMMGLMRSFNKNYIGFEKRSDLESRWMAIKLTFIILGLLVACL
ILLAMQGVVLRWLGVGAKWAAILSLFRWVLIVGLVFYAIAFIYKYAPAMQKRWKLLSPGS
ILATFLSLLATLGFSFFVSNFGKYNALYGSIGTIIVAMTLIYINALVLLIGYELNVSIHS
LKALADERARHETSGVTVP
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacttgaacgcatcttactgaacctgcctcctgtgaaattcctcacggaaaag
agcaagcatatcattttgccgggcttcgacaaagtgccattgtatgatgtgatcctgttc
tttctcagccaggtgaaaaaagtggggctcacggaacgcgccgcagcagtggcctataac
ttcatcatggccattccccctacctgcctgttcatctttacgctgatcccccaactgcct
ttcattccaaaggaaaccatcgaactgcagctgcatcacctgatcaacgatatcattcca
gcaaaggaatacaaccagggcatcatcgattttgtggatggcttcctgaaccagccacgc
gttggtctgatctccttcggtttctttttgctgatcttctttgccagtaatggcatgatg
gggctgatgcgcagtttcaacaagaactatatcggctttgaaaagcgtagcgacctggag
agccgctggatggctattaagctcaccttcatcatcctgggcctgctggtggcctgtctg
atccttttagccatgcagggcgtggtattgcgctggctgggcgtaggcgccaaatgggcc
gctatcctgagcctcttccgatgggtactgattgttgggctcgtattctatgctatcgcc
ttcatctacaaatatgcgcctgccatgcaaaaacgctggaaactcctctccccaggctcc
atcctggccactttcctcagcctgctggccactttggggtttagcttctttgtgagcaat
ttcggaaaatataacgcactctatggatctattggcactatcattgtggctatgacactg
atctatatcaatgccctggtgctgctgatcgggtacgagctcaatgtgagcatacactcc
ctcaaagcgcttgcggatgaaagggcgagacacgagacaagcggcgtgaccgttccatga

DBGET integrated database retrieval system