KEGG   Paraburkholderia graminis: CUJ91_08940Help
Entry
CUJ91_08940       CDS       T05548                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
pgp  Paraburkholderia graminis
Pathway
pgp00550  Peptidoglycan biosynthesis
pgp01100  Metabolic pathways
pgp01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pgp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CUJ91_08940
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CUJ91_08940
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pgp01003]
    CUJ91_08940
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pgp01011]
    CUJ91_08940
Enzymes [BR:pgp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     CUJ91_08940
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CUJ91_08940
Glycosyltransferases [BR:pgp01003]
 Polysaccharide
  Bacterial polysaccharide
   CUJ91_08940
Peptidoglycan biosynthesis and degradation proteins [BR:pgp01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   CUJ91_08940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AXF08041
LinkDB All DBs
Position
PHS1_A:2010992..2013508
Genome map
AA seq 838 aa AA seqDB search
MKRLIPLILETLDRGLTRVNPLVAAALWHLRHPTRRGVLKACAALPLLFVLYVLVLIPFT
PGIGDIRKAKIEQPARILSADGKLLAEFKPSNREWVKLKDISPNVVNALIATEDHRFYQH
FGLDWRRTASAALHTFSGDRQGGSTITQQLARNLYPDEIGRAPTLTRKLKEAITAFKIEA
LYTKDEILETYLNTVPFLYNAYGIEMAARTYFDKSASELNVLESATLAGMLKGNSYYNPV
LNPERALQRRNTVLAQMVKFGKLTPAAYQTLSKKPLRIDFERQTEPPGPAPHFAQQLRKW
LAAWADRNDYNLYSDGLVVRTTIDSRLQTMATQAVILQGNQLQGIANAAWGSRAGCSNGK
DLLATFLRETPDYRAAKDTGLSDDDALKRVSANRGLVQSVCESKTRVQADFLAMDPRNGQ
IRAWVGSRDFSQDPFDHVQQARRQPGSTFKPFVYAAAFEAGAKPSDTLLDQPVEIQLAGG
EVWRPGDEDEPSERPITLRDGLAYSRNRITAQLMQTVGPNKVARLARAMGVRDSPLEAVP
SLALGTSPVTLKEMVSAYGTIANLGGYVEPVMVTRIEDRNGEVLADFAPTPPQQELSADA
ARTLVDVMRDVVNRGTGSAIRGRFGVRGDVAGKTGTTQGNADGWFILIHPQLVAGAWVGF
NDSRVTLRSDYWGQGAHSALPIVGDFFQRAQRSKLVDTRVKFDTEHQPGWFAERSERLRA
WFQLLFPSTAPTVKPDAAVTARNTTRRAPVEVVSSEAGAAASAAASAAAAASEDTRALPP
LLTAPGAASGAAVLNEPVHGEARGAGTAASAPTPTPDDVMPPDAVSVEGQPSGAGASE
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcgccttattcccctgattctggagacactcgaccgaggtctaacccgcgtgaac
ccgctcgtggccgcggcgctgtggcatctgcgccatccgacccgccgcggcgtactcaag
gcgtgcgcggcgcttccgctgctgttcgtgctgtatgtgctggtcctgattccgttcaca
ccgggcatcggcgatattcgcaaggcgaagatcgagcagccggcgcgcattctctcggca
gacggcaaactgctcgccgagttcaagccgtccaaccgcgagtgggtcaagctgaaggac
atctcgccgaacgtggtcaatgcgctgatcgctaccgaagaccatcgcttctatcagcat
ttcgggctcgactggcggcgcacggcatcggccgcgctgcatacgttttctggcgaccgg
cagggcggctcgaccatcacgcagcaactcgcgcgcaatctttatcccgacgaaatcggc
cgcgcgccgacgctcacgcgcaagctcaaggaagcgatcacggccttcaagatcgaagcg
ctctatacgaaggacgagatcctcgaaacctacctgaacaccgtgccgtttctgtacaac
gcgtacggcatcgagatggccgcgcgcacgtacttcgacaagtcggcgtcggagctgaac
gtgctcgaaagcgcgacgctcgcgggcatgctgaagggcaacagctattacaacccggtg
ctcaatccggagcgcgcattgcagcggcgcaataccgtgctcgcgcagatggtgaagttc
ggcaagctcacgcccgccgcgtatcagacgctcagtaaaaagccgttgcgcatcgacttc
gagcggcagaccgagccgcccggacccgcgccgcacttcgcgcagcaactgcgcaaatgg
cttgcggcatgggccgaccgcaacgactacaacctgtattcggacggcctcgtggtgcgc
accacgatcgattcgcgtctgcagacgatggccacgcaggcggtcattttgcagggcaac
cagttgcaaggcatcgcgaatgcggcgtggggcagccgtgccggttgttcgaacggcaag
gacctgctcgcgacgttcctgcgcgaaacgcccgactaccgcgccgcgaaagatacgggc
ctctccgacgacgacgcgctcaagcgcgtgtcggcgaaccgcggcctcgtgcagtcggta
tgcgaatcgaaaacgcgcgtgcaggccgattttctcgcgatggacccgcgcaacggccag
atccgcgcgtgggtcggcagccgcgatttcagccaggacccgttcgatcatgtgcagcag
gcgcggcgtcagccgggctcgaccttcaagccgttcgtctacgcggcggccttcgaggcg
ggcgcgaaaccgtctgataccttgctcgatcagcccgtcgaaattcaactcgcgggcggc
gaagtctggcgtccgggcgacgaggacgaaccgagcgagcggcccatcacgctgcgcgac
ggcctcgcgtattcgcgcaaccgcatcaccgcgcaactgatgcagacagtcggtccgaac
aaggtcgcgcggctcgcccgcgcgatgggcgtgcgcgacagtccgctcgaggcggtgccg
tcgctggcattgggcacgagcccggtcacgctgaaggaaatggtctcggcatacggcacg
atcgccaacctcggcggatacgtcgagccggtgatggtcacgcgcatcgaggaccgcaac
ggcgaggtgctggccgacttcgcgccgacgccgccgcagcaggaactgtccgccgatgcg
gcgcgcacgctcgtcgacgtgatgcgcgacgtcgtcaatcgcggcaccggatcggcgata
cgcggacgcttcggcgtgcgcggcgacgtcgccggcaagaccggcacgacgcagggcaac
gcggacggctggttcatcctgatccatccgcaactcgtggccggcgcgtgggtcggtttc
aacgacagccgcgtgaccttgcgcagcgattactgggggcagggggcgcatagcgcgctg
ccgatcgtcggcgattttttccagcgcgcgcagcgctcgaagctcgtcgacacgcgcgtc
aaattcgacaccgagcaccagcctggctggttcgccgagcgttcggagcggttgcgggcg
tggttccagctactgtttccgtcgacggcgccgacggtcaagccggatgcggcggtgact
gcgcggaatacgacgcggcgcgcgccggttgaggttgtttcgtcggaggcgggggcggct
gcgtcggctgctgcttcggcagccgcggcggcgagcgaagacacgcgggcgctgccgccg
ttgctgacggcgcctggcgcggcttcaggtgcggcggttctgaatgagccggtccacggc
gaagcgcgcggcgccggcacagcggcgtcggcaccgacgcccacgcccgacgacgtgatg
ccgccggacgcggtgagcgtcgaaggtcagccgagcggagcgggtgcgtcggagtga

DBGET integrated database retrieval system