KEGG   Paraburkholderia graminis: CUJ91_10050Help
Entry
CUJ91_10050       CDS       T05548                                 

Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pgp  Paraburkholderia graminis
Pathway
pgp00020  Citrate cycle (TCA cycle)
pgp00310  Lysine degradation
pgp00380  Tryptophan metabolism
pgp01100  Metabolic pathways
pgp01110  Biosynthesis of secondary metabolites
pgp01120  Microbial metabolism in diverse environments
pgp01130  Biosynthesis of antibiotics
pgp01200  Carbon metabolism
Module
pgp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pgp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CUJ91_10050
  09105 Amino acid metabolism
   00310 Lysine degradation
    CUJ91_10050
   00380 Tryptophan metabolism
    CUJ91_10050
Enzymes [BR:pgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CUJ91_10050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF4604
Motif
Other DBs
NCBI-ProteinID: AXF08227
LinkDB All DBs
Position
PHS1_A:complement(2269023..2270306)
Genome map
AA seq 427 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLAQV
IANDGDTVTADQVIAKIDTEGKAGAAAVEAEVKPAPEASPAPAPAAAPAAQAASATGANT
AASPAAGKLMAEKGLSSGDVAGTGRDGRITKGDVLTAGAPAAKAAAPAPAAAPKAAKPSL
PDVKAPASADQWLKDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMDLRN
KYKDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRG
LVVPILRNADQLSLADIEKKIAEFGQKAKDGKLSIDEMTGGTFSISNGGVFGSMLSTPII
NPPQSAILGVHATKERAVVENGQIVIRPMNYLALSYDHRIIDGREAVLSLVAMKDALEDP
ARLLLDL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggctattgttgaagtcaaggttccccagctgtccgagtcggtctcggaagccaccatg
ctgcagtggaagaagaagcccggcgaggctgtggcgcaagacgaaattctcatcgaaatc
gagaccgacaaggtcgtgctcgaagtgccggcaccctcggccggcgtgctcgcgcaagtc
atcgcgaacgacggcgacaccgtcacggccgatcaggtcatcgccaagatcgacaccgaa
ggcaaggctggcgccgctgccgtcgaagccgaagtgaagccggctcccgaagcgtcgccg
gctccggctcctgctgccgcaccggccgcgcaagccgcatccgcaacgggtgcgaacacc
gctgcttcgccggctgccggcaagctgatggcggagaagggcctgtcgtcgggcgacgtc
gccggcacgggccgcgacggccgcatcaccaagggcgacgtgctgacggccggcgcaccc
gccgccaaggccgcagcgccggcaccggctgccgcaccgaaggccgccaagccgtcgctg
ccggacgtgaaggcgccggcatcggctgatcaatggctgaaggaccgcccggaacaacgc
gtgccgatgtcgcgtctgcgcgcgcgtatcgccgagcgtctgctcgagtcgcagcaaacc
aacgcgatcctgaccacgttcaacgaagtgaacatggcgccggtcatggatctgcgcaac
aagtacaaggacaagttcgagaaggaacatggcgtgaagctcggcttcatgtcgttcttc
gtgaaggcggctgttcacgcgctgaagaagttcccgctggtgaatgcgtccatcgacggt
aacgacatcgtctatcacggctacttcgacatcggtatcgctgtcggttcgccgcgcggt
ctggtggtgccgatcctgcgcaatgcagatcagctgagcctcgccgacatcgagaagaag
atcgccgagttcggtcagaaggcgaaagacggcaagctgtccatcgacgaaatgacgggc
ggtacgttctccatctcgaacggcggcgtgttcggctcgatgctgtcgacgccgatcatc
aacccgccgcagtccgcgattctcggcgtgcacgccacgaaggaacgcgccgtggtcgag
aacggccagatcgtgatccgcccgatgaactatctggcgctgtcgtacgaccaccggatc
atcgacggccgcgaagcggtgctgtcgctggttgccatgaaggacgcgctcgaagatccg
gcgcgtctgctgctcgacctgtaa

DBGET integrated database retrieval system