KEGG   Paraburkholderia graminis: CUJ91_14240Help
Entry
CUJ91_14240       CDS       T05548                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pgp  Paraburkholderia graminis
Pathway
pgp00020  Citrate cycle (TCA cycle)
pgp00480  Glutathione metabolism
pgp01100  Metabolic pathways
pgp01110  Biosynthesis of secondary metabolites
pgp01120  Microbial metabolism in diverse environments
pgp01130  Biosynthesis of antibiotics
pgp01200  Carbon metabolism
pgp01210  2-Oxocarboxylic acid metabolism
pgp01230  Biosynthesis of amino acids
Module
pgp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pgp_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CUJ91_14240
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CUJ91_14240
Enzymes [BR:pgp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CUJ91_14240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AXF08938
UniProt: A0A2Z5LW80
LinkDB All DBs
Position
PHS1_A:complement(3201625..3202881)
Genome map
AA seq 418 aa AA seqDB search
MPYQHIKVPTGGDKITVNADFSLNVSDQPIIPYIEGDGTGLDITPVMIKVVDAAVEKAYA
GKKKIHWMEIYAGEKSTRVYGPDVWLPEETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPVQYFKGVPSPVREPEKTNMVIFRENSEDIYAGIEWPAESEQAKKVIKF
LQEEMGVKKIRFPDTSGIGIKPVSREGTERLVRKAIQYAIDNDRRSVTLVHKGNIMKYTE
GAFRDYGYALAQKEFNAELIDGGPWMKVKNPKTGGDIVVKDVIADAFLQQILLRPAEYDV
IATLNLNGDYVSDALAAQVGGIGIAPGANMSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWLEAADLIIKSMETSILQKRVTYDFARLMEGATQVSCSGFGQVMIENM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccgaccggtggtgacaagatcaccgtcaatgcggat
ttctcgctcaacgtttcggatcagccgatcattccgtatatcgaaggcgacggcaccggc
ctcgacatcacgccggtcatgatcaaggtcgtggacgcagcggtcgagaaggcttacgcg
ggcaagaagaaaatccactggatggagatctacgcgggcgagaaatcgacgcgagtgtac
gggccggacgtgtggctgcctgaagaaacgctacaggtgctgaaggaatatgtggtgtcg
atcaagggaccgctcaccacgcccgtcggcggcggcatccgttcgctgaacgtcgcgctg
cgtcaggaactcgatttgtacgtatgcctgcgtccggtgcagtatttcaagggcgtgcca
tcgccggtgcgtgagccggaaaagaccaacatggtgatcttccgcgagaactccgaagac
atctacgcgggcatcgaatggccggccgaatccgagcaggcaaagaaggtcatcaagttc
ctgcaggaagagatgggcgtgaagaagatccgcttcccggatacgtcgggcatcggcatc
aagccggtctcgcgcgagggcacggagcgtctcgtgcgcaaggcgattcagtatgcgatc
gacaacgaccgccgctcggtcacgctcgtgcacaagggcaacatcatgaagtacacggaa
ggcgcgttccgtgattatggttatgcgctcgcgcagaaggagttcaacgcggagttgatc
gacggcggcccgtggatgaaggtcaagaatccgaagacgggcggcgacatcgtcgtcaag
gatgtgatcgccgacgctttcctgcagcagattctgttgcgccccgccgaatacgacgtg
atcgccacgctcaatctgaacggcgattacgtgtctgacgcgctggccgcgcaagtgggc
ggcatcggcatcgcgccgggcgcgaacatgtcggattcggtcgcgatgttcgaggccact
cacggtacggcgcccaagtacgcgggcaaagactacgtgaatccgggctcggaaattctc
tcggccgaaatgatgctgcgccatctcggctggctcgaggcggcggatctgattatcaag
tcgatggaaacgtcgattctgcaaaagcgcgtcacgtacgacttcgcgcgtttgatggaa
ggcgccacgcaggtgtcatgttcggggttcgggcaggtgatgatcgagaatatgtag

DBGET integrated database retrieval system